KEGG   Nicrophorus vespilloides: 108557246Help
Entry
108557246         CDS       T04922                                 

Definition
(RefSeq) venom allergen 5-like
  KO
K20412  peptidase inhibitor 16
Organism
nvl  Nicrophorus vespilloides
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nvl04090]
    108557246
CD molecules [BR:nvl04090]
 Proteins
  108557246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 108557246
NCBI-ProteinID: XP_017769176
LinkDB All DBs
Position
Unknown
AA seq 244 aa AA seqDB search
MEERECILDEHNLYRDKMARGEFSNHFLPKTSNMHVLSYDKEAEFIAGCYIKQCIWGHDK
TRLTVKGRNLGQNLYSYSVSVERNTLNCKLLRTSLDGWVNNELKFLNESNAASWGERYTF
LYEAGHLTQVLWSNTKYVGCAMLHSRRNGKAFHVYDVFCDYLPPGNYRNKAMYKKGEPAT
DCAPLKANDRYKHLCGPIRPISEDTYIPPTDAPGDMQFSEDNVNSFKCTPFLIFTIIINI
LFIL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcgagaatgtattctggatgagcacaatctgtacagggataagatggcacgc
ggcgaattctccaatcatttcctccccaaaacgagcaacatgcatgtcttgagttacgat
aaagaggccgaattcatagctggctgttacataaagcaatgcatctggggtcacgataag
actcgactgacggtgaagggtagaaacctaggacaaaacttgtacagttactcggtttcg
gtggagaggaacacactgaactgcaaattgctgaggacttcgctcgacgggtgggtgaac
aatgaacttaagttcctaaacgagagtaacgctgcttcgtggggtgaaagatacaccttc
ttgtacgaagctggtcatcttacgcaggtcctgtggagcaacactaagtacgtgggctgc
gcaatgcttcattccagaagaaacggcaaagcatttcacgtgtacgatgtgttctgcgac
tatctcccaccgggaaattatcgaaataaagccatgtacaagaagggagaaccggccacc
gactgcgccccgcttaaagcgaacgacagatataagcatctgtgcggtcctataagaccc
ataagcgaagacacatacatacctccaacggacgctcccggagatatgcaatttagtgaa
gataatgttaacagttttaagtgcaccccattccttattttcaccataattattaatatt
ttgttcatattataa

DBGET integrated database retrieval system