KEGG   Nicrophorus vespilloides: 108557301Help
Entry
108557301         CDS       T04922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase pr-set7 isoform X1
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108557301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nvl03036]
    108557301
Enzymes [BR:nvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108557301
Chromosome and associated proteins [BR:nvl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108557301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Myosin_tail_1 DnaJ_C
Motif
Other DBs
NCBI-GeneID: 108557301
NCBI-ProteinID: XP_017769248
LinkDB All DBs
Position
Unknown
AA seq 371 aa AA seqDB search
MVRGRRVRAVIACSDGSDCCSPLPKRKVKLQSKFAHSVLSPVNKKNQIISQFFQAVEVDI
DDAVCDLEVSSFDNRNNICIVDSDIPSDGINDLDDKEKEEFKGHCLMHISSEILATPLGK
NGPADLDILSPATPHRIELKDEQEDKVKNEAKIVQEKIEKKIIIAPRARRRLNANNAVNQ
QPPAAKPTIKGNNNETSHKLTEYFPVRRSVRKTNKIALEEKQRTLEQNLRKGIEQGLRIR
NFEGKGRGVVANKMFQRGDFVVEYSGDLIDTAEAKRREVKYAQDQNTGCYMYYFKHKSQQ
YCIDATAETGRLGRLVNHSRNGNLVTRTIDVDGLPRLVLVAKDTIEIGNEVTYDYGDRSK
ESLRYHPWLAY
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggtcagaggaaggagagtcagggctgtgatagcgtgcagcgacggcagtgattgctgt
tcaccgcttccgaaacgcaaagtgaaactgcagagcaagtttgcccattcagttcttagc
ccagtgaataagaaaaatcaaatcatttctcagttctttcaggctgttgaagtggatatt
gatgatgccgtttgtgatttagaggtgtccagtttcgacaataggaacaatatatgcatc
gttgattctgatatacctagtgatggaatcaatgacttagatgacaaggaaaaggaggaa
ttcaaaggacattgcttgatgcacatctcctcagagatattggcgactccgttgggtaag
aatggccccgctgatttggatatactgtcgccggcaacaccacataggattgagttgaag
gatgagcaagaggacaaagtgaaaaatgaagccaaaattgtacaagagaaaatcgaaaaa
aagattatcatagcacccagagcgagacggaggttgaatgctaataatgcggtaaatcaa
caaccacccgcggcgaaacccactatcaaaggaaacaacaatgagacgagtcataaactc
acagagtatttcccagttagaagatccgtgcgaaaaactaataaaattgctttagaggag
aaacagcgcacgcttgaacaaaatttaaggaaaggcatcgaacaaggattaaggatacga
aatttcgaaggaaagggtagaggtgttgttgcaaacaagatgttccagcgcggtgatttt
gttgtcgaatactccggagatcttattgatactgccgaggccaagaggagagaggttaaa
tacgcccaggatcaaaacacaggttgttatatgtattacttcaaacacaagagtcaacag
tattgcatcgatgcgacagcggaaactggtcgtttgggtcgtctggtgaaccactctcga
aatggcaacttggtcactagaacaatcgacgttgatggattgccgcgcttagtgttagtc
gcaaaagacacaatcgagattggcaatgaagtgacttacgattacggtgacagatcgaaa
gagtctcttaggtatcatccttggttagcgtactaa

DBGET integrated database retrieval system