KEGG   Nicrophorus vespilloides: 108557599
Entry
108557599         CDS       T04922                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog A-like
  KO
K20017  Bcl-2 family protein
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl04214  Apoptosis - fly
nvl04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108557599
   04215 Apoptosis - multiple species
    108557599
SSDB
Motif
Pfam: Bcl-2 Pas_Saposin Tmemb_9
Other DBs
NCBI-GeneID: 108557599
NCBI-ProteinID: XP_017769675
LinkDB
Position
Unknown
AA seq 296 aa
MENNCSLTHEHRKVTFETPQISRLTLGKPPFPTRKLSFPAALHANLLGIASNGKLDDKQE
QYNAKRRFSNVSDAVSRKLSTTIGWRIPAVPPKDVIAQGRVLCGQYIRNRLKRSGIFNKK
MGLYRLRSMVGTTSGIVVREVFPGLIGAGIELERMHPKLYTNVARHTSLTPGGIIVSDEA
AAGLLVAIGHQLFKSDISWGKVISIFAIAGGLAVDCVTQGHSEYINALMDGMEEILRVDL
GTWIASNGGWPALTHLCRTEDDEVTLIEYVTLVIIVLLLILIFYFIFRLLVRLGIF
NT seq 891 nt   +upstreamnt  +downstreamnt
atggaaaataactgcagcttgacacatgagcaccgcaaagtgacgtttgagacgccgcag
atatcacggctgactttgggaaagcccccgtttccgacgcgaaaactaagttttccagcc
gcactgcacgcgaatttactcggaatcgcatcaaacggaaagctcgacgataaacaggaa
cagtacaatgcgaaacggaggttcagcaatgtcagcgatgctgtctcgagaaaattatca
acgacaatcggatggaggattcctgcggttcctccgaaggacgtgattgctcagggaagg
gttttgtgtggtcagtatataaggaaccgtctgaagaggtcggggattttcaacaagaag
atgggactgtacaggctgcgtagcatggtcggaactaccagtgggatagttgttagggaa
gtgtttccaggtttgattggagctggaatagaattggagaggatgcatccaaagctgtac
acaaacgtagctcgacacactagtttaactccaggcggaatcattgtatccgacgaggca
gctgccggtcttttggtggctataggacatcagctatttaagtctgatatcagttgggga
aaagtgatctccatattcgcaatagccggaggattagccgttgactgtgtgacgcagggg
cattcagaatatatcaacgctctaatggatgggatggaggaaatacttagagttgattta
ggcacttggattgctagcaacggcggatggcccgcattaacccatttgtgtcgaacggaa
gacgacgaagttacgctcattgaatacgttaccttagttattatagtcttacttttgata
ttgattttctacttcatatttcgccttttagtaagattaggaattttttaa

DBGET integrated database retrieval system