KEGG   Nicrophorus vespilloides: 108558385Help
Entry
108558385         CDS       T04922                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase
Organism
nvl  Nicrophorus vespilloides
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 108558385
NCBI-ProteinID: XP_017770774
LinkDB All DBs
Position
Unknown
AA seq 532 aa AA seqDB search
MPATGEQNVQEDFVDEAIASDVATSEDDEGYPQDLKKPYKPIASIESHPNRNQHESFIRE
SVEILLKDAVFNGLSRDSKVLEWRNPEELLKLLDFEIRASGSSHDELLQLIRETIQYSVK
TGHPYFVNQLFSSVDPYGLVGQWLTDALNPSVYTYEVSPVFTLMEEVVLKEMRTIVGFPN
GDGDGIFCPGGSMSNAYAISCARHSLMPDIKRTGLHGLQRLVLFTSEDAHYSIKKMASFL
GLGSDNVYLIKSDGRGKMDVEHLTSEIERSLRENAIPFMVSATAGTTVFGAFDPIEEIAD
VCERHKLWLHVDAAWGGGALMSKKYKHLLKGIHRADSVTWNPHKLLTAPQQCSAYLLRHK
GVLSSAHSTNAAYLFQKDKFYDTSFDTGDKHVQCGRRADVLKFWFMWKAKGTSGFEQHID
KVFDNAEFFTNTIQKTEGFSIVLDNPECTNICFWYIPPSLRGHETDADYHEKLHSVAPKI
KEKMMKEGSMMVTYQAQKSLPNFFRIVFQNSGLNHDDMIHLIQEFERLGYDL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgccagccactggggagcagaacgtgcaagaggacttcgtggatgaggccatagccagc
gacgtcgccacctccgaggacgacgaaggatacccgcaagatctgaagaagccttacaaa
ccaatcgcatccatcgaaagccatccgaacaggaatcagcacgagagtttcatcagagag
tccgtggagatactcctcaaggatgctgtattcaatggattatcaagggacagcaaagtc
ttggaatggaggaatccggaggagttgctgaaactcttggattttgaaattcgcgcaagc
ggatcatcgcacgacgaactccttcagttgatcagggagacgatacagtattccgtgaag
accggacatccgtacttcgtgaatcaactgttctcctccgttgatccgtacggcttggtt
ggacaatggttgacggacgcgctgaatcccagcgtttacacctacgaagtatctccggtt
ttcaccttaatggaggaagttgtgctgaaagagatgaggacgatagtaggtttccccaac
ggcgacggagatggcatcttctgcccaggtggatccatgtccaacgcttatgcaataagt
tgcgccagacatagcctcatgccggacatcaaaagaacaggtctgcacggattgcagcgc
ttggtgctcttcacctccgaggatgcgcactattccatcaagaagatggcttcgttcttg
ggtctgggctcggataacgtgtacctcatcaaatcagacggtagagggaaaatggacgtg
gagcatttaacatctgaaatcgaaagatctcttcgggaaaacgcgatcccgttcatggtc
agcgcaaccgcaggcacaacagttttcggagccttcgatcctatcgaagaaatcgccgac
gtctgcgaacggcacaagctctggttgcacgtggacgccgcttggggtggcggagcattg
atgtccaagaagtacaagcatcttctgaaaggaatccacagggccgattccgttacatgg
aaccctcacaagttattaactgcaccgcagcagtgttccgcttacctgctcaggcacaaa
ggagttctatcatctgctcattccacaaacgcagcatatctcttccaaaaagacaaattc
tacgatactagcttcgatactggagacaagcacgtgcagtgcggacgaagagccgatgtc
ctcaaattctggttcatgtggaaagccaaaggaacttccggtttcgaacagcacatcgat
aaggtcttcgataacgctgaattctttaccaacaccatccagaaaacggaaggattctcc
atagttttggataatcccgaatgcacgaacatatgcttttggtacataccaccaagtttg
cgtggacacgaaaccgatgccgattaccacgaaaaactgcattccgttgctcccaaaatc
aaagagaaaatgatgaaggaaggctcaatgatggtcacgtatcaagcgcagaaaagctta
cccaacttcttccgaatcgtcttccaaaattccggtttaaatcacgacgatatgatccac
ttaatacaagagttcgagcgactgggttacgacctctaa

DBGET integrated database retrieval system