KEGG   Nicrophorus vespilloides: 108558908Help
Entry
108558908         CDS       T04922                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl04146  Peroxisome
nvl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108558908
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108558908
Enzymes [BR:nvl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108558908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 108558908
NCBI-ProteinID: XP_017771455
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MAKAVCVLNGEVKGTLWFQQDGEKGPVVVSGEVSGLKQGLHGFHIHEFGDNTNGCISAGP
HFNPQGKDHGGPTSDVRHVGDLGNVEAGSNGVAMVSISDKEISLFGNNSILGRTLVVHAD
PDDMGAGGHELSKTTGNAGARLACGVIGIASKK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcagtgtgcgttctgaacggcgaggtcaaggggacgctgtggttccaacag
gacggagagaaaggtccggtcgtcgtctccggcgaggtgtccggcttgaagcagggcctc
cacggattccacatccacgagttcggtgacaacaccaacggttgcatctcggccgggccc
cacttcaatccgcagggcaaggatcacggcggtcccacctccgacgtacgtcacgtcggt
gacctgggcaacgtagaggccggtagcaacggcgtcgccatggtgtccatctccgacaag
gagatctcgttgttcggcaacaacagcatcctgggacgcaccctcgtcgtccacgccgat
cccgacgacatgggagcgggcggacacgaactcagcaagaccacaggaaacgccggcgct
cgtctcgcttgcggcgtcatcggcatcgcctccaagaagtaa

DBGET integrated database retrieval system