KEGG   Nicrophorus vespilloides: 108559187
Entry
108559187         CDS       T04922                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00230  Purine metabolism
nvl01100  Metabolic pathways
nvl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108559187
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108559187
Enzymes [BR:nvl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108559187
SSDB
Motif
Pfam: Guanylate_cyc AC_N RINT1_TIP1 Glyco_tranf_2_4
Other DBs
NCBI-GeneID: 108559187
NCBI-ProteinID: XP_017771850
LinkDB
Position
Unknown
AA seq 582 aa
MGDGQQVVMQGKIRSKLIWSSFRDSYLEKLYQSYSVRQKRAGLECFLHTAILFDLYMLMV
PSGQDALVFAIMSAFLTANCCLLVWCKRGMQKCAIWPAVPHICWHLANAQLLASLFLKKN
EVTSRDSLGWVLLLDYLIYVTLPLRLRYCIILSIGTCASYLAAIIGLAKFETHVLEQHIA
NCILLLTANLLGLTSYFVEEKQQRRAFLETRQSLEVKLVIEEQSAEQERLLLSVLPEHVA
VQMRQDLDSADSQFKKIYMSRHENVSILYADIVGFTAISSTYSAQELVKMLNELFARFDK
LADKYHQLRIKILGDCYYCISGAPQERPDHAVLCVHMGLSMVKAIKYVQQTTNSPVDMRV
GIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGLAGRVHISATTLSFLSGEFEVEPA
YGEKREESXGEKREESLRIAGLKTYFIVSVLKPFQSDVKLEVQNGAGVLHEEDSCVINDS
VSDGTAGKCEETQNGNQLVAMRSRQDSEDFKMRLRKELVNRDGHRELHKSTNFCTLSFRN
QDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAATSS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgggcgacggtcagcaagtggtgatgcagggcaagatccgctcgaagttgatctggagt
tcgttcagggattcgtacctggagaagctctaccagagctacagcgtccgacagaagcgc
gccggactcgaatgcttcctgcacacggccatcctcttcgacctctacatgctgatggtg
ccgagcggacaagacgctcttgtcttcgcgatcatgagcgccttcctcacggccaactgc
tgcctcctcgtctggtgcaaacggggaatgcagaagtgcgctatttggcctgccgttcct
cacatctgctggcatctggctaacgctcagctcctcgcctcactcttcctcaagaagaac
gaggtcacttcaagggatagcttaggttgggtcctcctgctcgactacctcatctacgtc
actcttcctctcaggctcagatactgcatcatcctaagtattggaacgtgcgcttcctac
ttggctgcgatcatcggattggcaaagttcgaaacgcacgtacttgaacaacatattgca
aattgtatattgctgttgaccgccaatcttctgggtttaacgtcgtactttgttgaggag
aagcagcagagaagagctttcttagagacgcgacaatcattagaggtgaaactcgtaatt
gaagagcaaagcgctgaacaggagaggcttttgctgtccgtgttgcctgagcacgtcgca
gttcagatgaggcaggatctggacagtgcggatagtcagttcaagaagatctacatgagc
cgacacgagaacgtcagcatcctctatgcagacatcgtcggattcacggccatctcatcc
acttattccgcccaggaactggtcaagatgctcaacgaattgttcgctcgtttcgacaaa
cttgcagacaaatatcatcaattgaggataaaaatcttaggagattgctactactgcatc
agtggagctcctcaggagagaccggatcacgccgttctctgcgtccatatgggtctttcc
atggtaaaagccatcaaatatgtgcagcagacgacgaattccccagtcgatatgagggtg
ggaatccatacgggggcggttctcgccggcgttttgggccagaggcagtggcaattcgac
gtctactcgaaggacgtggagctggccaacaaaatggagagcagcggattagccgggaga
gtgcatatatcagctacaactctttcgttcctgagtggagaattcgaagtggagccggcg
tacggtgaaaagcgagaagaatcctntggtgaaaaacgagaagaatccttgagaattgcc
ggcctgaagacgtatttcatcgttagcgtcttaaaaccgtttcaatcggatgtgaagctg
gaggtgcagaacggagctggagtccttcacgaggaagacagctgcgtgatcaacgactca
gtttctgatggaacagcgggaaaatgcgaggaaacgcaaaacggaaaccaattggtcgcg
atgagatcccgacaggattccgaagacttcaagatgagactcaggaaggaactggtgaat
cgcgacggacacagggaactgcacaaaagcacgaatttctgcacactatcattcaggaat
caagatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncgcgtgcggcaaca
tcatcctga

DBGET integrated database retrieval system