KEGG   Nicrophorus vespilloides: 108559818Help
Entry
108559818         CDS       T04922                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl04146  Peroxisome
nvl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108559818
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108559818
Enzymes [BR:nvl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108559818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu RestrictionSfiI
Motif
Other DBs
NCBI-GeneID: 108559818
NCBI-ProteinID: XP_017772668
LinkDB All DBs
Position
Unknown
AA seq 196 aa AA seqDB search
MIRTAVFLVLATVVLAEDLATVKITGSDNKVSGLVTFKKSGKGIEIEGQIEGLIQGKHGF
HIHQLGDLSNGCASTKGHFNPHKKPHGAPDSNIRHVGDLGNIVADENGVAKISMFDNVIS
LDGDNNIIGRAVVVHSGEDDLGQGEGNDTLTTGNAGGRVGCGVIGRATEGSSVLIQPLMP
AILISFIVAMVTSTVL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatccgaaccgcagtattcctggtcctagcgacagtcgttttagccgaggatttggct
acagtcaagatcacaggatccgataataaagtcagtggtttagttacattcaagaagtca
ggaaaagggattgaaatcgaaggacagatcgaaggtttaatacagggaaaacatggtttc
cacatccatcagttgggtgatcttagcaatggttgcgcatccaccaaaggtcacttcaat
ccacataagaaaccgcacggagctccggattccaatatcaggcacgtcggagatttaggt
aacatcgttgcggacgagaacggcgttgcgaaaatctcgatgttcgacaacgttatctct
ttggacggtgataataacatcattggaagggctgtcgttgtgcacagcggtgaagatgac
ttaggtcagggtgaaggcaacgatacccttaccaccggaaacgcgggaggtcgcgttgga
tgcggtgttatcggaagagcaactgaaggatcaagtgtcctgattcaaccacttatgccg
gccatcttaataagtttcattgttgctatggttacttcaaccgttttgtag

DBGET integrated database retrieval system