KEGG   Nicrophorus vespilloides: 108560967Help
Entry
108560967         CDS       T04922                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00020  Citrate cycle (TCA cycle)
nvl00190  Oxidative phosphorylation
nvl01100  Metabolic pathways
nvl01200  Carbon metabolism
Module
nvl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nvl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nvl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108560967
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108560967
Enzymes [BR:nvl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108560967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 108560967
NCBI-ProteinID: XP_017774197
LinkDB All DBs
Position
Unknown
AA seq 656 aa AA seqDB search
MSAILKTANLLAASTKVGLSRPALSKALHISVNRKDAKVNTSMSSSYPVIDHDYDAVVVG
AGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDNWQWHMYDTVK
GSDWLGDQDAIHYMTREAPKAVIELENNGMPFSRTQDGKIYQRAFGGQSLKFGKGGQAHR
CCCVADRTGHSLLHTLYGQSLRYDCNYFIEYFAMDLLMENGECRGVIAMNLEDGSIHRFR
SKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRAGLQNQDLEFVQFHPTGIYGAGCLIT
EGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVFLQL
HHLPVEQLHSRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLTNENGQ
DKVVPGLYACGESASSSVHGANRLGANSLLDLVVFGRACAKTIAAENKPGEKIGALSQNA
GEFSVANLDCARYANGSIPTAALRLNMQKTMQAHAAVFRTASVLQEGIKKMEQRYKELKD
VKVHDSSLIWNSDLVETLELQNLMLNAMQTIVGAENRKESRGAHAREDFKDRIDELDYSK
PLDGQTRKPMEEHWRKHTLTTMDPSTGEVTIKYRPVIDETLNQQECATVPPAIRSY
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgatcctgaaaacggcgaacctcctcgcagcttccacgaaggttggactgagc
aggccagccctatcgaaagccctgcacatctcagtcaaccgtaaagatgctaaagttaac
accagcatgtcatcatcgtatccggttatcgatcacgactatgatgctgtggtcgtcgga
gctggaggcgctggactcagggccgcctttggacttgtcgccgagggatttaagactgct
gtcattacgaaactgtttccgaccagatctcacaccgtagcagctcaaggtggtatcaac
gctgctttaggcaacatggaggaagacaattggcagtggcatatgtacgatacggtgaag
ggatccgattggctgggcgatcaggatgccatccattacatgacgagggaggcgccgaag
gctgtcatcgagctggagaacaacggaatgccgttctcgcgtacgcaagacggtaaaatc
tatcagagggccttcggaggtcaatctttgaagttcggcaagggcggacaagctcacaga
tgctgctgcgtagcggacaggaccgggcacagtctgttgcataccttgtacggacaatcg
cttcgctacgactgcaattacttcatcgagtactttgccatggatttgctgatggagaac
ggagagtgccgaggcgttatcgccatgaacctcgaggatggtagcatccacagattcaga
agcaagaatactgtattggcgacgggcggttacggtcgcgcctacttctcctgcacgtcc
gcccacacctgcaccggtgatggtactgccatggtgagccgcgccggtctccagaaccag
gatttggaattcgttcaattccatccgactggcatttacggtgccggctgtttgatcacg
gaaggttgccgcggcgagggtggctacctgatcaactcgcaaggtgaaaggttcatggag
cgttacgcccccgtagccaaggatctggcatcacgcgacgtcgtttcccgcagtatgacc
atcgaaatccgcgaaggtcgcggttgcggacccgaaaaggatcacgtcttcctgcagctg
catcatttaccagtggagcagttgcactcgcgtctgcctggcatttcggagacggcgatg
atcttcgccggcgtcgacgtgacccgcgaaccgatccccgtacttccgaccgtccactac
aatatgggcggcgtgccgaccaactacaagggacaagtgctgaccaacgagaacggtcaa
gacaaagtcgttcccggactgtacgcctgcggcgaatccgcttcctcgagcgtgcacggc
gccaaccgtctcggcgccaactcgcttttggatttggtcgtcttcggcagagcttgcgcc
aagaccatcgccgccgagaacaagccaggagagaagatcggtgctctgagccaaaacgcc
ggtgaattctccgtcgccaatctggattgcgctcgctacgccaacggcagcatccccacc
gccgctctcagattgaacatgcagaagacgatgcaagcgcacgctgccgtcttcaggact
gcgagcgtcctccaggagggcatcaagaagatggaacagcgctacaaggaactgaaggac
gtcaaggtccacgacagcagtttgatctggaactccgatctggtggagacactggaattg
cagaacctgatgttgaacgctatgcagaccatcgtcggagcggagaaccgtaaagagtcc
cgtggcgctcacgccagggaggacttcaaggacagaatcgacgagctggactacagcaaa
ccgttggacggacagaccaggaagcccatggaggagcactggaggaagcacactctgacc
accatggatccatccaccggtgaagttaccattaaatataggcccgtcatcgacgaaact
ttgaaccagcaggagtgcgccaccgttcccccagcgatcagatcgtactaa

DBGET integrated database retrieval system