KEGG   Nicrophorus vespilloides: 108561339Help
Entry
108561339         CDS       T04922                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00052  Galactose metabolism
nvl00500  Starch and sucrose metabolism
nvl01100  Metabolic pathways
nvl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108561339
   00500 Starch and sucrose metabolism
    108561339
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108561339
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108561339
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108561339
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108561339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 108561339
NCBI-ProteinID: XP_017774708
LinkDB All DBs
Position
Unknown
AA seq 836 aa AA seqDB search
MMTPENTNFVDQYREPEEVIQVRNDREKKGLSWFKKFWYNFVELAKTHLFIGLAFFVIIA
VVVPVLVYYYSNDYLGEVDPKPICVQSKKFRVPCGNYTYTECIANLCCYDDDDLFCFHSL
PSAYNYKRLDKSEKFERTQYATPYKNPMYREMKVSYIENNENFLTVAMHGLDVEVTETVV
PDKNYEVQPINNSLVAEVRRDTGQLILTTSLGPMIASDHYWIWTVHLSDNHLFGFGELLL
NHTEIVTKVIYRNRNDHNTLPVFLAEEKGLFHGLSIRNRGPLEVSVLPSNLIVIKSLVGE
RIDLDLFLGPTAKDVMQQMRKPKPKLKEWFLKPHFCSNGKSDITEIINKPTEHLVKTSMF
VSDCLHEDLLMRAYSDNSNIKKALEEISQSKHLILSLPPQVPKKSTSYEVLQSLFFKSNI
PNFNWMGKYQNEDVSFVDFSLQESKLWFENVLKVLSVNSEIISGYALTQNWPADDKYKFP
ANRETFPYLSDELVLALTKTLPWNILNSKKEKHYVVHNDYALDQLKSADEKDFVLLSSPD
DESRSLGFIENVPTTWGSFKEMMVRNLFYGFFVNPLISTPVCGTNHTFDDDTLCFRWYMM
SATMPIIRSSDLWPNKLGHGKIIAENALKIRESLIPYFWMFLDNDEPLARPMFYDFPDDN
ATFPLDEQYMLGDKLLVGQIVLPDVFIKNVYLPMVDGGWFEFWGGINYPDSGWINFPVVE
SDWIMFIKSGSIVPLKSENPKQLPEESYSLAIAYDMTDPSANATGTLILDSITFSFVADE
NGLAISRTQECNQPDIKYKIDNLRIYDGESITNFKKEIDLCGNLDEIDDIQIVPIS
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaccagagaatacaaacttcgtggatcagtacagagagcccgaagaggtgata
caggtgcgcaatgacagggaaaagaagggattatcttggttcaagaaattctggtataat
ttcgttgaattggcgaaaacccacctcttcattggactcgcgttcttcgtgatcatcgcg
gtggtagtgcctgtgctagtttattactacagcaatgattacttgggtgaggtggatccg
aaaccaatttgcgttcaatcaaagaagttccgtgttccctgcggcaattacacgtacact
gagtgcattgcaaacctgtgctgttacgacgacgatgatctcttctgcttccactcgtta
ccatcggcttacaactataagagattggataaatcggagaagtttgaaagaacgcagtac
gcgacgccatacaagaatccgatgtacagggagatgaaagtatcttacatagagaacaac
gagaattttctgactgttgcaatgcacggtctagatgttgaagtgaccgaaaccgttgtc
cctgataaaaattacgaagtgcagcctataaataatagtttggtggcggaggtgcgtcgg
gacaccggtcaactgatcctaactacttcgctgggcccaatgatagcatccgatcattac
tggatttggacggttcacttatccgataatcacctcttcggcttcggagaactgcttcta
aatcacacggagatcgttacaaaggtgatttatcgcaacaggaacgaccacaacacgctt
ccggtattcctggcggaggagaagggactctttcacggcctgtccatccgaaaccgcggc
cctctggaagtttccgtcctgccctcgaacctgatcgtaatcaaaagtttggtgggcgaa
cggatcgatctggatctgttcctcgggcctacagcgaaggacgttatgcaacaaatgcgc
aaacctaaaccgaaactgaaggaatggttcttaaaaccacacttctgcagtaatggaaaa
tcagatatcacagaaataattaacaaacctacagaacatttagtaaaaacaagcatgttt
gtttctgattgtttgcacgaagatctattgatgcgcgcttacagtgataattcgaatatc
aaaaaagcattggaagaaatatcacaatcgaaacatcttattttgtcgttaccacctcag
gtacctaaaaaatcaacttcttacgaagttttgcaatcattattttttaaatcgaacatt
cccaattttaattggatgggaaaatatcagaacgaagacgtatcgttcgtagatttttct
ttgcaagagtccaaattatggttcgaaaatgtattgaaggtgctttctgtaaatagtgag
ataatatcaggatacgctttaactcaaaattggcctgctgatgataagtacaaattcccg
gcaaatagagaaacgtttccgtatctatcggatgaacttgttttggccttgacgaaaact
ttaccttggaatatattgaacagtaagaaagaaaaacattacgtcgttcataacgattat
gctttggatcagctgaaatctgctgatgaaaaggactttgttcttctctcatcacctgac
gatgagtctcgttctttgggtttcatcgagaacgtcccgaccacttggggtagtttcaaa
gagatgatggtgaggaacctcttctacggtttcttcgtaaaccctttgatctccactccg
gtttgcggtacgaaccatactttcgatgatgacacgctctgcttccgatggtacatgatg
tcggctacaatgccgatcattcgaagctcagacttatggccaaataaactgggtcacggc
aaaatcatcgcggaaaatgctctgaaaattagggaatctctaataccgtacttctggatg
tttctggataacgacgaaccgttggctcgaccgatgttctacgatttcccagacgacaac
gccacgtttcctctggacgagcagtacatgctcggagataaacttcttgtcggacaaatc
gttctaccggacgtcttcatcaaaaacgtttacctaccaatggtcgatggaggatggttc
gagttctggggtggaattaactatccggattccggttggatcaactttcctgtcgtcgag
tccgactggatcatgttcatcaaatccggatcgattgttccgctgaagagcgagaaccca
aaacaattacctgaagaatcttattcattggctatagcatacgacatgactgatccaagt
gcaaatgcaacaggaacgctcatcctggattcaataacgttttcatttgtagcagatgag
aatggtctggcaattagtaggacgcaggaatgcaatcaaccagatattaaatataaaatc
gataatttacgcatctacgatggagaaagcataacgaattttaaaaaagaaatagatttg
tgtggaaatttagatgaaatagatgatattcaaatagttccaatttcgtaa

DBGET integrated database retrieval system