KEGG   Nicrophorus vespilloides: 108562145Help
Entry
108562145         CDS       T04922                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl03030  DNA replication
nvl03410  Base excision repair
nvl03420  Nucleotide excision repair
nvl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108562145
   03410 Base excision repair
    108562145
   03420 Nucleotide excision repair
    108562145
   03430 Mismatch repair
    108562145
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nvl03032]
    108562145
   03400 DNA repair and recombination proteins [BR:nvl03400]
    108562145
Enzymes [BR:nvl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108562145
    6.5.1.6  DNA ligase (ATP or NAD+)
     108562145
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108562145
DNA replication proteins [BR:nvl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108562145
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108562145
DNA repair and recombination proteins [BR:nvl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108562145
   NER (nucleotide excision repair)
    Other NER factors
     108562145
   MMR (mismatch exicision repair)
    Other MMR factors
     108562145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 108562145
NCBI-ProteinID: XP_017775852
LinkDB All DBs
Position
Unknown
AA seq 867 aa AA seqDB search
MAQRSITSFFIRVTPKDSTTSYGASIAKVSSHQLKRTRESSSVDDNEENMPTKNTQKELT
NKKNSAKRQKTVKVLPDSVQNIIKTTEKDVDNNSSDSNLSIKNAPLRSEKKKNKHRLINS
DSSEDEVLIKKESPKKEKKLEVFFKKEAENLKAKKKKQHVIESDYSSDEVESPKKQETKD
VVVKKEPEVEKKSMLDFFKGNSKTKTDTNVSGVDYNPTLGKYDPIECATWQHGQKVPYMA
LARSLEEIENVSARLKMIEILSNFFRSVLVLTPDDLLPSVYLCLNKLAPAYEGIELGIAE
TSLMKAIAQSTGRTVAQIKADAQEVGDLGIVAERSKSNQRMIFQPAPLYVRGVFDKLKDI
AKMTGHSSQTKKVEKIQSMFVACKHSEARFLIRSLAGKLRIGLAEQSVLQALALACTLTP
PNQSYPPKKLNVSKGMSTESFKNLQEEMTLIIKTTYCECPNYDLMIPVLLKEGIEKLPEY
CKLTPGIPLKPMLAHPTKGVHEVLQRFDGLRFTCEWKYDGERAQIHIHDNGDVSIYSRNQ
ENNTSKYPDIISRLVHCKTDNVKSCILDCEAVAWDKEKKQILPFQILSTRKRKDANEEDI
KVQVCVFMFDLLFLNGERLVTKPFSYRRELLKENFKEYEGEWCFATSMDTKTMEEVQEFL
DESVKGNCEGLMVKTLDEDATYEIAKRSRNWLKLKKDYLEGVGDTLDVVVIGGYIGKGKR
TGTYGGFLLACYDADNEEYQSICKIGTGFTDEYLQTHTDFLKSHIISEPKSYYRYDSSHE
PDHWFDAVQVWEIKCADLSLSPVHRAAMGIVDPEKGISLRFPRFIRIRDDKNVEDATSAQ
QVADMYSNQDQIKNQQGGGKSLEEDFY
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaggagcataacgtccttctttattagggtcacaccaaaggattcaacaaca
agttatggagcttcaattgctaaggtatcttcacaccaattaaagagaactagagaatcc
agcagtgtagatgacaatgaagaaaatatgcctactaagaatacccaaaaagaattaaca
aataaaaagaattcagcaaaaagacaaaaaactgtgaaagtattgcctgattcagttcaa
aatattattaaaactactgaaaaagatgtagacaataacagcagtgatagtaatttgtct
attaaaaatgctccacttagatctgaaaagaagaaaaacaagcatcgtctcattaactct
gatagcagtgaagatgaagttctcattaaaaaagagagtccaaagaaggaaaagaaattg
gaagttttctttaagaaagaagctgaaaatttaaaagcaaagaagaagaagcaacatgta
attgaatctgactacagttcagatgaagttgagagtcctaaaaaacaagaaacaaaggat
gttgtggttaagaaagaacctgaagttgaaaagaaatccatgcttgattttttcaaagga
aattcaaaaacaaaaactgatactaatgttagtggagttgattataatccaacattggga
aaatatgatccaattgaatgtgctacatggcaacatggacaaaaggtaccttatatggcg
ttagctaggtccctggaagagatagaaaacgtgtcagctcgattaaagatgattgagatc
ttaagtaatttcttccgatctgttctggttttgaccccagatgacttattgccgagtgtc
tacctatgtttgaacaaattagccccagcatacgagggaattgaattgggaattgccgaa
acatcactgatgaaagcaatagcgcagagtactggaagaactgtggcacaaataaaagcg
gatgcccaagaagtgggtgatcttggaatcgtggccgaacgctcaaaaagtaatcagcgt
atgatatttcaaccggctccgctgtatgttcgtggtgtcttcgacaagctcaaagatata
gcgaaaatgaccggacattcttcacaaactaaaaaagtagagaaaatccaatcgatgttt
gtagcttgtaaacattccgaagcacggtttttaatccgatcgttggcgggaaagcttagg
ataggcttagcggaacaatctgtattgcaagcgttggctctggcctgtacgttgacgcca
ccgaatcaatcttatccacctaaaaaattgaatgtttctaaaggaatgtccacagaatct
ttcaagaatttacaagaggaaatgactttgataattaaaacaacctattgcgaatgtcca
aattatgatctgatgatacctgtacttctcaaagagggtatcgaaaagcttcccgaatac
tgcaagctcactccgggtattccactcaaacctatgttagcacatccgacaaaaggcgta
cacgaagtcctccagcgattcgatggtctcagattcacatgcgaatggaaatatgatgga
gaaagagcgcagattcacatacatgataatggtgatgttagcatttatagtaggaatcaa
gagaacaatacttcaaaatatcccgatataatttctcgtttggtgcactgtaagactgat
aatgttaagtcctgcattttggattgcgaagctgtcgcgtgggataaggaaaagaaacaa
atattgccattccaaatattgagtacgcggaaacggaaggatgcgaatgaagaggatata
aaagttcaagtttgcgtattcatgtttgatttgctattcctaaatggagaacggttagtt
acgaaaccattctcgtataggcgtgaattgctgaaagagaatttcaaagagtacgagggt
gagtggtgctttgccactagtatggacaccaagacgatggaagaggttcaagagttcttg
gatgagagcgtcaaaggtaattgtgaaggtttgatggtaaagacgctggacgaggatgcc
acatatgaaattgccaagaggtcgcggaattggttaaagttgaagaaagattacctggag
ggcgttggagatacgctagatgtagtcgtcattggtggatatattggtaaaggaaaacgg
actggaacttacggcggttttctattggcttgctacgacgccgataacgaagaataccaa
agcatttgcaagattggaaccggttttactgatgaatatcttcaaacgcatacagatttc
ttgaagagtcatataatttctgaaccgaaatcgtactatcgctacgattcatctcacgag
cctgaccattggttcgacgctgttcaagtgtgggagataaaatgtgcagatctctccctc
tcgccagtccatcgagcagcaatgggcatagttgatcctgaaaagggtatttcccttagg
tttccacgtttcatcaggattcgagacgacaagaacgtagaagatgccacctcagcgcag
caagtggccgacatgtactccaaccaggaccaaattaaaaatcaacaaggcggcgggaaa
tcgctggaggaagacttttattag

DBGET integrated database retrieval system