KEGG   Nicrophorus vespilloides: 108562636Help
Entry
108562636         CDS       T04922                                 

Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl03440  Homologous recombination
nvl04068  FoxO signaling pathway
nvl04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    108562636
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108562636
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108562636
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvl01001]
    108562636
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nvl03032]
    108562636
   03400 DNA repair and recombination proteins [BR:nvl03400]
    108562636
Enzymes [BR:nvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108562636
Protein kinases [BR:nvl01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   108562636
DNA replication proteins [BR:nvl03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108562636
DNA repair and recombination proteins [BR:nvl03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    108562636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT FATC TAN
Motif
Other DBs
NCBI-GeneID: 108562636
NCBI-ProteinID: XP_017776533
LinkDB All DBs
Position
Unknown
AA seq 2729 aa AA seqDB search
MSLKENLCNLFSKKLNDRKSGTENLFNLINNKRTIDYLENPDVDLDWNDIYSNVFKALVQ
ELQRIDGNKLNGVKTPNSNFVMVNSLKDLLVSIVKVANRKRGQIEFKSIHQSLKKCINET
TYRDLCLKEFLLIMREHVLPKFMYWITITKEEWNDLLTDLDNVRTYNEDSAKAIICIQQC
MFHGSKHKLQRAGFKQHYEIIVNISKTVTIASQGWMKESLLEMVLTFCKNHMNDCRMLCC
ELGETILGNLIQLYENYAKQNNITLLLLEIFIIQLKIHHPNGASENETYAYANSWPAWKR
ILKFLYSFIDNVFKISDKFLLQYAENKKYFHPLFAKFAVEVFKQKNHVYDPISDATQKRV
CADFGFMQLVDEIEGSKNWTWIYLCNEIIKKYPKLLCATAYIRLLKFLANYIFECKLAYE
YTLVFNCLTSLLDMESVFGREQLREQEIDVIWTSLWDTSLKVLGLAMNTEENHNFIRRMI
VLKKAPRNNQLIMMYKLKKVKISEDSLKTLNLLCSEHCLTDNSERDLLHWVMQNDIYEHF
QCAVYAETIVHLILTQWPKVSELGLKVTDQRHSDGRDDLNVEEFRNIDQSLRSDDVQISA
TVHKDYVINREAFEELLDLLGNLCEKVANNDIENVNNIFYVMICFLNIVNYFKIYKIDDG
VKSLIILLRKLNEGTVWDISVKLLKKANERGRFLNKEIIQLLQKVFSVDLEDAIKVPVDF
ISTAFSFLAVEEEGQDVENPIDVKVNSAKESMNLEILNMICQFAFASNGGGELRSQAKQV
LLNPTLDFNNDIQYEQMITVLRFTKRTENISFMDVLEILKRICQDRYQEHRIASDILEIV
YNVLENTLLHDYEDLYALLDPFYDGRHNYSIDIIMKLVDCYGMIGDMKAMFMIADFLLHD
SIMVRMNAIKTFTNILKKQRLFDYGVFEMQKDFFKKICIVNEKLFETVIEIGDDDGLSNR
LATVLYALGSIICYCSAFRKIALFELFKISHIQDIDLHKLSKMIKIISKEIGCENSYAFL
ENSLDYLLLQWITKGFSLKKFPYTLLGCLTDSNFYNTYMSSILPILFNEKEETDFENICE
KIGCSVQNVIKEAYPFVKIRSLVESNLEDSKLNEVINRRLTKYLPEDDRKQLIENRIDDV
FIAAIQFVFDMDDFKIIFNMDYCLPLPDTTHVDIAGFQNILTLLQEDINWANFMEVLITK
KDKLQQILLKLTKKIHKATSREERILSFYRYVVFLQLIHPQLIDRRFCLNNYLIRDITYT
LVNLIDGNINEVHKLAIIYLKKFINDILPGCVTAFQEYLPVIVGSLVPIADQTTEISDDA
MNVMNIIFQENAKRLEEGLKYLDPLPDKDRFSELRLLHHKVKYDQVNCALGQEIEYFLKA
GELVTRAGCRTEGLKYLRSKLKTKKDELKILYNELYLYRGVSNSTSNLHKLVYKLMDLAI
STDSAESLEATKCIGELGSADLTTMVLKNEEPHDDLNAKPTHLAAARIMTSLIHFLVDQN
IDVVCATSDALYSILKCNEGNSAANKLIPRSIQYLKPFICTTKTKQINMEVDNKFLEVIK
NEDLWCPERILDHNQWIVSLTSEILNCINKPEWYKTLIPLCKLKVSFAESLLPLLVNIIV
EQNNKYFKIISESIGMFFEKHWDLHWNGKNNECGLVMMQKPSVKCMLTTVHFIRLHRNTL
SNASNLKTNVELQINHLHVALAAQFCSAHFSASMFAELWCQREIVKKANVLNNNASVLAT
ICETSDDSKALKSILKETYRNIGDKDALLPCQLIDPCDLPHYIQFHKSIDFETSLINCGL
YELAANNNSASVQYECLWRLGRWDGLSEREPTNTFDCHYYSALKALNDNDLVSLGESVER
ARSVLLESFRHESLESCKHLYKSTTEFQCLHELEDVKKAVATDNYKHFLIDWLIKDSINP
NEFKYVERILSHRIAILNILVSNDNTEVMSDLIDYQLKLSSLARSQSNFNVARRCVDNLQ
KNMYMDELSKQKITLEHAQIIWNIHKPTGMYMLKDLLKEAGGDERFVSKSLKLYGHWSIE
SKSETTESIISNYFLKSIDLLNKYRARDSSSEIVDEICDSYDVLACFVDEKYQEIMDYIE
SPLFQDKIKKMETFKKSECEVKSKTRSSNYDERVAAITYSKQSNIDETEIGITLKEKNNY
LELAVKYYLLNLKFSNKSNIKLYRVISLWLNNKSNVELMAKINVNLPKVPSYKLLAVLPQ
LVPHITNNDDDSFGQLVNSLVENCAKEHPHHVIPIILSVSHSDKDSEYSDTSLITRNEPR
TLGAQIMITRLKQISKIKRIIEQLEDTTLALIQLAYYNTDLSKGTNVHSENFFKIPNTFK
IRKIRNYDDALLVTCNLDIKPNCDYGNIVGIYKYDLEYNLVGGINAPKRIKCTGTDGIAR
RQLVKGKDDLRQDAVMQQVFEMLNELLAGNKETFNLRIRTYKILPLSQRSGVLEWVEDSM
TIGEYLTGTKNRPGAHKMYNPGDITPESCHNQLKSVQDMPSDRKLAVYNKICKQLRPVFH
KFFETTFLYSTEWYEKRRAYTQSVATTSICGYILGLGDRHLNNILLDKKTAEVIHIDFGI
AFEQGKALKTPETVPFRLTRDIVDGMGISGVDGCYTSSCEKTMSVLRNNVNTITAILEVL
LYDPLYIWKITPYRVLNCQKEINDDAITSLETAPVNLTAERALSRLRQKLLGIEWGQFYT
VEQQVARLIQEAKNPENLSKLFCGWRPYL
NT seq 8190 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaagagaatctctgcaatttattttcaaaaaaattgaatgataggaaaagt
ggtacagagaatttgttcaatctaattaataataaaagaactattgattacttagaaaat
ccagatgttgatctagattggaatgatatatattcaaatgtttttaaggctttagttcaa
gaattgcaacgtattgatggtaataagttgaatggtgtaaagactccaaacagtaatttt
gtaatggtaaatagtttaaaagatttacttgtttccattgtgaaagttgctaatcgaaaa
cggggccaaatagaatttaaatcaattcaccaaagtttgaagaaatgcattaatgagaca
acatacagagatttatgtctcaaagaatttcttctaattatgagagaacatgttctccca
aaatttatgtattggattacaattaccaaagaggaatggaatgatttgttaactgatttg
gacaatgtacgtacatataatgaggattctgcaaaagctattatctgcattcaacaatgt
atgtttcatggaagtaaacataagttgcagagagcaggctttaaacaacattatgaaatt
attgtgaatatttccaaaactgttacaattgcttcacaaggctggatgaaagaatcttta
ctggagatggttttaacattttgtaaaaatcatatgaatgattgtagaatgttgtgctgt
gaattaggagaaaccatactgggaaatttaatacagttgtatgaaaactacgccaaacag
aataatataacgttattacttcttgaaatatttattatacaattgaaaatacatcatcct
aatggagcgtcggagaatgaaacttacgcttatgcaaattcttggccagcatggaaaaga
attttaaaatttctgtattctttcatagataacgtttttaaaattagcgataagttcctt
cttcaatatgcggaaaacaagaaatattttcatccgctttttgcaaaattcgccgtggaa
gtatttaaacagaaaaatcatgtttatgatccaatttctgatgcaactcagaaacgtgta
tgtgcagatttcggttttatgcagttagtagatgaaattgaaggttcaaaaaattggact
tggatatatttatgcaatgaaattattaaaaaatatcctaaactcttatgtgctacagct
tacataagacttttgaaatttctggccaattatatatttgaatgtaaacttgcctacgag
tatacattagtctttaattgtcttacatcattgcttgatatggaatctgtatttggacgt
gaacaattaagagagcaagaaattgatgttatatggacttccttgtgggatactagctta
aaagtcctaggtttagctatgaacaccgaagaaaatcataattttataagacgcatgatt
gtcttgaaaaaagcaccaaggaataatcaattgattatgatgtacaagttgaaaaaagtt
aaaatttcggaagacagtttaaaaacattgaatctgttatgcagcgagcattgcttgacg
gacaattctgaacgggatttattacattgggtcatgcaaaatgatatttatgagcatttc
caatgcgcagtgtatgctgaaactattgttcatttgatactaacgcaatggcctaaagta
agtgaacttggtttaaaagtaacggatcagagacattccgatggaagagatgatttaaat
gtagaagaatttagaaacatcgatcaaagtttaagaagtgatgatgtgcagatatcagcg
accgttcataaagattacgttataaatagagaagcattcgaggaattgctagacttactg
ggaaatctctgcgagaaagttgcaaacaatgatattgagaatgtgaacaacattttctac
gtgatgatatgttttttgaatatagtaaactattttaaaatttataaaattgatgatggc
gtgaagtctttgataatattactaagaaaactgaacgaaggaacagtctgggatatatcc
gtgaagctattaaagaaagcaaacgaaagaggacgttttttgaacaaagaaattattcag
ttactacaaaaagtattttccgttgacttggaagatgcaattaaagtaccggtagatttc
atatctacagcattttcgtttctcgcagtagaagaagaaggacaggatgtcgaaaatcct
attgatgttaaagtgaacagtgctaaagagtcgatgaatttagaaatattaaatatgatt
tgtcagtttgctttcgcttctaatggtggtggtgaattaagatctcaagcgaaacaagtt
cttctcaatcctactttggatttcaacaatgacattcaatatgaacaaatgataacagtt
ttaagatttaccaaacgcactgaaaacattagctttatggatgttttggaaatactgaaa
agaatttgccaagaccgttatcaagaacatagaattgcatcggatattttggaaatcgtt
tataatgtactcgagaatactttgcttcatgattatgaagatttatatgcattactcgat
cctttttacgatggcagacataattatagtatagatattataatgaaactcgtggactgt
tacggaatgattggagatatgaaggcaatgtttatgatcgcggattttcttcttcatgat
agtataatggttcgcatgaatgctattaaaacattcacaaatatactgaagaaacaaagg
ctctttgattatggtgtctttgaaatgcaaaaagatttttttaagaaaatttgcatcgta
aatgaaaaactgttcgaaactgtgatcgaaatcggcgacgatgacggactctcgaatcga
cttgcaacagttttgtacgcattgggaagtatcatatgttattgcagcgcgtttcgtaaa
attgcattgttcgagcttttcaaaatatcgcatattcaagacatagatctgcataaactt
agtaagatgattaaaattatatcgaaggaaattggctgcgaaaactcttacgcgtttcta
gaaaacagtttggattatttgttgttgcaatggataacgaaggggttttcattgaaaaag
ttcccatacacattgttgggatgtctgacggactcgaatttctataacacgtacatgtcg
tccattttgccaatactgtttaacgaaaaggaggagacggactttgaaaatatttgcgaa
aaaattggatgcagcgttcaaaatgtcattaaagaggcgtaccctttcgtaaaaatcaga
agtttagtcgagtcaaatttggaagatagcaaattgaatgaagttatcaataggagatta
acaaaatatttacctgaagacgatagaaaacaattaattgaaaatagaattgatgatgtt
ttcattgcggcaatccaatttgtttttgatatggacgacttcaagataatattcaatatg
gattactgtttgccactgccagataccacacatgtcgacattgcaggttttcagaacata
ttaacactactgcaagaagatattaattgggcaaatttcatggaagttttgattacaaag
aaagacaagcttcagcaaattcttctgaagctcacgaaaaagatacacaaagcgacgagc
agagaagagcgaattttgagcttttacagatacgtagtctttctgcaactaattcatcct
caattgatcgaccgccgattctgcttgaacaactatttaatacgagatataacttatact
ctggtgaatctaatcgatggcaacataaatgaagttcataaattggccataatatattta
aaaaagtttattaacgacattttgcctggttgcgttacagcgtttcaagagtacttgcct
gtaatcgtgggaagtcttgtacctatagcggatcaaaccacagagatatccgatgatgca
atgaatgtaatgaatattattttccaagagaacgctaaacgtctagaggagggtttgaaa
tatttagatccattgcccgataaggatagattttccgaattgcgattgctgcatcataaa
gtgaaatatgatcaagttaattgcgcactcgggcaagaaattgaatactttttgaaggcc
ggtgaattggtgacgcgggcaggatgtcgcacagagggtttgaaatatctaaggagtaag
cttaaaacgaaaaaagacgaactcaaaatactgtacaacgagttgtacttgtatcgtggt
gtttcgaattcgacgagtaatttacacaaacttgtatacaaattgatggatcttgccatt
tcgactgattcggcggaaagcttggaagccacgaaatgtataggtgaattgggatccgct
gatttaacaacgatggtattgaaaaatgaagaaccccacgacgacctcaatgcaaaaccc
acgcatcttgctgccgctcgcataatgacatcgttaatacattttcttgtagaccaaaat
atcgacgtggtatgtgccacctccgatgcactatactcaattttgaaatgcaacgagggc
aacagtgctgcaaataagttgattcctcgtagtattcaatacttgaaaccattcatatgt
acgacgaagacaaagcaaattaatatggaagttgacaataaatttctggaagtaatcaaa
aatgaagatctttggtgtcctgaacgtatattggatcataatcaatggatagttagtttg
acttcagaaatactgaattgtatcaataaaccggaatggtataaaacgttgattccattg
tgtaaattgaaagtttcctttgccgagtcgctactgcccttgcttgtaaatataattgta
gagcagaataataagtattttaagattatatcagaatcgattggaatgtttttcgagaag
cattgggatttgcactggaatggcaaaaacaacgaatgtggattagttatgatgcagaag
ccgtctgtaaagtgtatgctaactaccgttcattttattaggcttcatagaaacacatta
agtaacgcttcaaatttgaaaaccaacgtcgaactgcaaataaaccatctgcacgtggca
ttggcggcgcaattctgttcggcgcatttttcagcatctatgtttgcagaattatggtgt
caacgagaaattgttaagaaagcaaatgtgttgaacaacaatgcttctgtgttggctaca
atctgcgagacatcagacgattcaaaggcattgaaatctatactgaaagagacgtatcgt
aatatcggcgataaagatgcattgcttccttgccaattgatagatccatgtgatcttccc
cattacatacaattccacaagtccattgattttgagacatctttaataaattgtggtttg
tacgagttggccgcgaataataattccgcaagtgtacaatacgaatgcctgtggcggttg
gggcgttgggatggtttgtcggaacgcgaaccgaccaacactttcgattgtcactattac
agtgcgctgaaggctctgaatgataatgatttagtaagtctcggtgaatctgtcgaaaga
gcaagatccgttttgttggaatcgttcaggcatgagagcttggaaagttgtaagcatttg
tacaaatctacgacggaatttcaatgcttgcatgaattggaagatgtgaagaaagcggta
gcaactgataactataaacactttttaatcgattggctcatcaaagattctattaatccc
aatgaatttaagtacgtcgaaaggattctgtcgcatcgcatcgccatactaaatatatta
gtatcaaatgataacactgaagtaatgagcgatcttattgattatcagttaaaattatca
agtttagcacgatcgcagagcaattttaatgtggcaagaaggtgtgtcgataatttgcaa
aagaacatgtacatggacgaattatcaaaacagaaaattacattggaacatgcacaaatt
atatggaatattcataaacctactggcatgtacatgctgaaagatttactcaaagaagcc
ggaggcgatgaacgatttgtgtcgaaatcattaaaattatatggacactggtcaattgaa
tcaaaatcggaaacaactgaatcaataatatcaaattactttttgaaatctattgatttg
ttgaataaatatcgcgcaagagattcttcttcggaaatagtggacgaaatatgtgatagt
tacgatgtgctggcttgtttcgtggatgagaaatatcaagagataatggattatatcgag
agccctctgtttcaagataaaatcaagaaaatggaaacatttaagaaatctgaatgtgaa
gtgaagagcaagacgagaagctctaattatgatgagagagtggctgctataacgtattcg
aaacagagtaacatcgatgaaaccgaaattggaattactcttaaagaaaagaataattat
ctggagctggccgttaaatattatctgctaaatttaaagttcagcaataagtcgaatatt
aagttgtacagggtgatttcgctgtggctaaataacaagtctaacgtcgaactgatggca
aaaataaatgtgaatttaccgaaagtgccaagctacaagcttttagcagtgctgcctcaa
ttggtgccgcacattacaaataacgatgacgattcgttcggacaactggtgaatagttta
gttgaaaattgtgctaaagagcatccgcatcacgttataccaataatactttcggtatca
cattctgacaaagattccgaatactcggatacatctcttattacaaggaacgaacctcga
acattgggagcgcaaattatgataacaagattgaaacaaatatccaaaattaaaagaata
attgaacaattggaagacactacgctcgcattgatccaattagcttattacaatacggat
ctttccaaaggtacaaacgtccattcagaaaatttctttaaaattccaaatacgtttaaa
attagaaaaataagaaactacgacgatgcattgttagttacctgcaatttagatattaaa
cccaattgtgattatggaaatatcgtgggtatttacaaatacgatctggaatataattta
gttggtggaataaacgcaccgaaacgcatcaaatgcacgggaaccgacggaatagctaga
cgacaacttgttaaaggaaaggatgacttaagacaagatgctgtcatgcaacaagttttt
gaaatgctgaacgaattattggctggtaataaagaaactttcaatttgcgtataagaaca
tacaaaatattaccactttcgcagcgtagcggagttctggaatgggttgaagattcaatg
acgattggcgaatatttaacaggtaccaaaaacagaccaggcgcacataaaatgtataat
cccggtgacatcactcccgaatcgtgtcacaatcaactgaaatccgtgcaggacatgccg
tctgatagaaagttggccgtgtataataaaatttgtaagcaattaaggccggtctttcat
aaattctttgagaccacttttctgtactctactgaatggtacgaaaaacgccgcgcttat
acgcagagtgttgcaacaaccagcatatgtggatacatcttgggattgggtgatcgacat
cttaacaatatactgttggataagaaaacagcggaagttattcacatagattttggtatt
gcgtttgagcaaggcaaagccttgaaaactccggaaactgttcctttcagattaactaga
gatattgtagatggcatgggtatttcaggagtcgacggttgctatactagttcttgcgag
aaaactatgagcgtcttgagaaataatgttaacacaataacagctattttggaagtcctt
ctatatgatccactgtacatatggaaaattacgccgtaccgtgtattgaattgtcagaag
gaaattaatgatgatgccattacttctttagaaactgcgccagtaaacttgactgctgaa
agagcattaagtagattacgacaaaagttgcttggaattgaatggggtcaattctatact
gttgagcagcaagtggccagactgatacaggaggcaaagaatcctgaaaatttatcaaaa
ctgttttgtggctggagaccatatttataa

DBGET integrated database retrieval system