KEGG   Nicrophorus vespilloides: 108562681Help
Entry
108562681         CDS       T04922                                 

Definition
(RefSeq) dolichol-phosphate mannosyltransferase subunit 1
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00510  N-Glycan biosynthesis
nvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    108562681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nvl01003]
    108562681
Enzymes [BR:nvl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     108562681
Glycosyltransferases [BR:nvl01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   108562681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 108562681
NCBI-ProteinID: XP_017776588
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MVKSTKNNKYSILLPTYNEVENLPIIIWMIVKYMDQSNYNYEIIIIDDGSPDGTLDAAKQ
LQSIYGDSKIILKPREKKLGLGTAYIHGMKHATGNFILIMDADLSHHPKFIPEFIKLQEA
NNYDVVSGTRYLGNGGVSGWDFKRKLISRGANFLTQLLLRPGASDLTGSFRLYKKDVLQK
LIESCVSKGYVFQMEMIVRARQMKYTIGEVPITFVDRVYGESKLGGSEIVQFSLALLHLF
ATT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtctactaaaaataataaatattctatattattacccacatataatgaagtt
gaaaatctgccaatcattatttggatgattgttaaatacatggaccaaagcaattataat
tatgagataataatcattgatgatggtagtccagatggcacattggatgcagccaagcag
ctgcaatcaatctatggtgattcaaagataatacttaaacccagggaaaagaaattgggt
cttggcactgcttacattcatggtatgaagcatgcaactggaaattttattttaatcatg
gatgctgacctaagtcatcatccaaaatttatacctgaattcatcaagctgcaggaagct
aataattatgatgtggtctctggtacaaggtaccttggaaatggtggtgtatctggctgg
gacttcaagcgcaaactcatatctagaggtgctaatttcctcacccaattactgctcagg
ccaggagctagtgacttaactggatcatttagattgtataagaaggatgtactgcaaaaa
ctcatcgaaagttgcgtgtcgaaaggatacgtcttccagatggagatgatcgtgagagcg
agacaaatgaaatacactatcggtgaagtgccaattacttttgttgatcgcgtctacggt
gaatcaaaattgggaggatcggaaatagtccaattcagtctggcccttctacatttattc
gccacgacgtaa

DBGET integrated database retrieval system