KEGG   Nicrophorus vespilloides: 108563044Help
Entry
108563044         CDS       T04922                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00250  Alanine, aspartate and glutamate metabolism
nvl00280  Valine, leucine and isoleucine degradation
nvl00410  beta-Alanine metabolism
nvl00640  Propanoate metabolism
nvl00650  Butanoate metabolism
nvl01100  Metabolic pathways
Module
nvl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    108563044
   00650 Butanoate metabolism
    108563044
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108563044
   00280 Valine, leucine and isoleucine degradation
    108563044
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108563044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nvl01007]
    108563044
Enzymes [BR:nvl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     108563044
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     108563044
Amino acid related enzymes [BR:nvl01007]
 Aminotransferase (transaminase)
  Class III
   108563044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 108563044
NCBI-ProteinID: XP_017777077
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MLSKAVKPSVIKNIINKGAVRTVTSLVPGEPNGPSVKTEIPGPRSKELIKELSAIQQSNA
VQFFADYEKSLGNYIVDADGNVMLDAYTQISSMPLGYNHPNLLKVFNNDKNMRTLINRPA
LGVFPGEDWPKKLKDVLLAVSPNLPNVTTMMCGSCSNENAYKNLFIAYRRNERGENVSFT
EEENASCMINQAPGAPKLSILSFHGAFHGRTLGVLATTHSKAIHKLDIPSFDWPIAHFPQ
YKYPLADNVRENAEEDKKCLAEVEDLIVTYKKKGIPVAGIVIEPIQSEGGDNEASPEFFQ
QLQRIAKKHGAGLLIDEVQTGGGPTGKMWCHEHFNLETPPDIVTFSKKMQIGGYFHNLEM
QPATPYRIFNTWMGDPGKMLIVEEILKVVKQQNLLDVVNKTGLKLKSGLEQLQNEFPALL
NSVRGRGTFLAMNAANTKLRDDLVNRMKQKGIQSGGCGEISIRLRPALIFQEHHADIFLD
TFRQVLKETK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgaaagcggtgaaaccgtcggtcatcaagaacatcatcaacaagggtgctgta
aggactgtgaccagtttggtgccaggagaacctaatggacccagcgtgaaaaccgagatt
cccggacccaggtcgaaggaactcatcaaagagctgagcgctattcagcaatccaacgcc
gttcaattcttcgccgattatgaaaagtctttgggaaattacatcgtcgatgctgatggc
aatgttatgctggatgcgtacacccaaatctcatccatgcctttgggttacaaccaccca
aatcttctgaaggttttcaataacgacaagaatatgcgcactttgattaatcgcccagcg
cttggcgtattcccaggagaagattggcccaagaaattgaaggacgttttacttgccgtt
tctccaaacttaccgaacgtcaccacgatgatgtgtggatcttgttccaacgagaacgcc
tacaagaacttgttcattgcttaccgccgcaacgaacgtggagaaaacgttagcttcacc
gaagaggaaaacgcctcgtgcatgatcaatcaagctccaggtgcaccaaagttgtccatt
ctctccttccacggcgccttccatggtagaactttgggagtgttagccaccacccactcg
aaagccatccataagctcgacattcccagtttcgactggcccatcgcccatttcccgcag
tacaagtatcctctggcggacaacgttagagagaacgctgaagaggataagaaatgttta
gccgaagtcgaagatctgatcgtaacttacaagaagaagggaatcccagtcgctggtatc
gtcatcgaacccatccaatccgaaggtggcgacaacgaagcctctcctgagttcttccaa
caactacaaagaatcgccaagaagcacggagccggtcttctgatcgatgaagttcaaaca
ggcggtggacccaccggaaagatgtggtgccacgagcacttcaatctggaaactcctcca
gatatcgtcaccttcagcaagaagatgcaaatcggtggatacttccacaacctggaaatg
caaccggcgactccgtacaggatcttcaatacttggatgggagatccaggaaagatgttg
atcgttgaggagatcctcaaagtcgtcaagcagcaaaacctcttggacgttgtaaacaag
accggattgaagttgaagagtggtttggagcagctccagaatgaattccccgctcttctt
aactccgtcagaggacgcggtacattcttggccatgaacgcggccaacacaaagctcaga
gatgatcttgtgaacaggatgaagcagaagggtatccaaagcggcggatgcggagaaatc
tctattcgtttgaggccagccctcatcttccaagagcatcatgccgacatcttcttggac
accttcagacaagtcttgaaagaaacaaagtaa

DBGET integrated database retrieval system