KEGG   Nicrophorus vespilloides: 108564856Help
Entry
108564856         CDS       T04922                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00500  Starch and sucrose metabolism
nvl01100  Metabolic pathways
Module
nvl_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108564856
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nvl01003]
    108564856
Enzymes [BR:nvl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     108564856
Glycosyltransferases [BR:nvl01003]
 Polysaccharide
  Storage polysaccharide
   108564856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 108564856
NCBI-ProteinID: XP_017779519
LinkDB All DBs
Position
Unknown
AA seq 691 aa AA seqDB search
MSRERSARRFYRAESSSNLMAYMDRGMLAEEENRWTFEIAWEAANKVGGIYTVIRSKAYV
STEEMGDQYCLIGPYKEASARTEVEESPLGSQSLNEAVSAIRDKGYKVVTGRWLVDGNPQ
IILMDVGSAAWKLDEFKTELWEKSSLGVPHLDVEANDAIIFGNMVADFLEEFHTSAKLCA
GGGQPRIVAHFHEWQAGIGLMLTRLRHVNVATVFTTHATLLGRYLCAGNTDFYNNLATFS
VDEEAGKRQIYHRYCIERAATHLSHTFTTVSDITGYEAEHLLKRKPDVITPNGLNVKKFS
ALHEFQNLHACSKEKIHEFVRGHFYGHYDFDLDKTLYFFIAGRYEFGNKGADIFIEALAR
LNHLLRNINSDITVVAFLIFPAKTNNFNVESLRGHAVTKSLRETINDIQTKIGKRMYEIC
LSGRMPDSKELLEKEEMVRLKRCIYSLGRDGLPPVTTHNVVDDWNDPVLCSVRRCNLFNR
SNDRVKIVFHPEFLSSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSIT
TNLSGFGCFMQEHIADPMSYGIYIVDRRFISLDDSINQLAQYMFDFARLNRRQRIIQRNR
TERLSDMLDWRNLGVYYRQARMKALHALFPELEKEIENGIGCSIKYPRPISEPPSPTSSR
HTTPATSLHGSDDESDSVDEEGELEELRNQR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagagagcgatccgcccgaagattttaccgagccgaatccagttcaaatctgatg
gcttacatggatagaggcatgctggccgaggaggaaaacagatggaccttcgagattgcg
tgggaagcggctaataaagttggaggtatttacacggtgatacggtccaaggcgtacgtt
tctacggaggagatgggcgatcagtattgtctgatcggtccatataaagaggccagtgca
agaactgaagtggaggagagtccgttgggatcgcagtctctgaacgaggcggtttcggcg
atcagggataaaggttacaaagttgtgacgggcaggtggttggttgatggaaatcctcag
atcatcctgatggacgtgggatcggccgcttggaagttggatgagttcaagaccgagctt
tgggagaagagctcgctgggtgttccacatctggatgttgaagcaaacgatgcaataata
tttggaaatatggtggcggatttcttagaagagtttcatacgagcgccaaactatgcgcc
ggtggtgggcagccaagaatcgtggcgcattttcacgagtggcaggcaggaatcggattg
atgttgaccagattacgacacgtgaacgttgccaccgtgttcacaacgcatgccaccttg
ttaggaagatacctgtgcgctggaaacacggacttttacaacaatctggctactttcagc
gtcgacgaagaagcgggaaaacggcagatatatcataggtactgcatagaaagagcggcc
actcacctatcccatacattcaccacggtttcagatatcacaggctacgaggcggagcat
ctgctgaagcgaaaacctgatgttattacaccgaacggcctgaacgtaaagaagttttcc
gcgctccacgaatttcagaatttgcacgcctgttcgaaagagaagatacacgaattcgtt
aggggtcatttctacgggcattacgattttgatttagacaagactttatatttttttatt
gctggtcgatacgaattcggcaacaaaggcgcagatatattcatcgaggctttggcgaga
ttgaaccacctgcttagaaatattaactcggatataacggttgtagcctttctcatattc
ccagccaagacgaacaattttaatgtagaatcgttgcggggtcacgcggtcacgaagagc
ttgcgtgaaaccatcaacgacattcagacgaagatcggaaagcgaatgtacgagatctgc
ttgagcggtcgcatgccggattccaaggagctgttggagaaggaggaaatggtgaggctt
aagcggtgcatttactcgttgggaagagatggtttaccaccggtaaccacacataacgtc
gtcgacgattggaatgatccagtcctatgctcggtgcgaagatgcaacctattcaacaga
tcgaacgatcgagttaaaatcgtatttcatccagagtttcttagctcaactaatccttta
ttcggtttggactacgaggagtttgtcaggggttgtcatttaggagtgtttcccagttat
tacgagccatggggatacactccggccgagtgcaccgttatgggaatacccagcatcacc
acgaatctatcgggcttcggttgttttatgcaagagcacatcgcggatcccatgtcctac
ggaatatatatagtagacagaaggtttatctcgctagacgacagcatcaatcagttggcg
cagtacatgttcgattttgcgcgcctcaatagaaggcaacgaattatccagaggaaccga
accgaacggttaagcgatatgttggattggagaaacttaggagtctactacaggcaagca
aggatgaaggcattgcatgcgctcttccccgaactagaaaaggaaatcgaaaacggaatc
ggctgttccatcaagtatccaagaccgatttccgaacctccaagtccaacgtccagtaga
cacaccacaccggccacctcgttgcatggaagcgacgatgaatcggattccgtcgatgaa
gaaggagagctggaagaattgagaaatcaacgttaa

DBGET integrated database retrieval system