KEGG   Nicrophorus vespilloides: 108565180
Entry
108565180         CDS       T04922                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl04013  MAPK signaling pathway - fly
nvl04214  Apoptosis - fly
nvl04215  Apoptosis - multiple species
nvl04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108565180
   04391 Hippo signaling pathway - fly
    108565180
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108565180
   04215 Apoptosis - multiple species
    108565180
SSDB
Motif
Pfam: TNFR_c6 DUF5447 SelP_N
Other DBs
NCBI-GeneID: 108565180
NCBI-ProteinID: XP_017779983
LinkDB
Position
Unknown
AA seq 243 aa
MGIFTSCKVLLAAPALTTILVLLCFPPTTVSALCLKDQYLNYELQKCMNCTICESKNQVV
FIPCQVYKDTQCAPLGILLEYLNSQSKKHRHQNHRHSGVHRSEHHRHVGGESTETTMAGS
AEPPFNTAEELIWDWQAIALTCAVCSCIIFFLVVALYSLYQAKQWRRLKVNYEADVEELS
ARLSLMASSNNEKGDPENPNLGTIDPNYLNNRCVYLEKLLHGRKDKRLGSESGNVYIDEN
MKT
NT seq 732 nt   +upstreamnt  +downstreamnt
atggggatttttacgtcttgtaaggtgttattggcggcgccggccttgaccaccatcttg
gtgctgctgtgctttccaccgacgacagtgtcggcgctctgcttgaaggatcagtacctg
aactacgagctccaaaaatgcatgaactgcacaatatgcgaaagcaagaatcaagtcgtt
ttcatcccgtgccaggtctacaaggacacccagtgcgccccactgggtattcttttggag
tacctcaattcgcagagcaagaagcatcgccatcagaaccatcggcacagcggtgtccac
aggtccgagcatcacagacacgtcggtggagaaagtaccgaaacgacgatggcaggcagc
gcggaaccacctttcaacaccgccgaagagctcatctgggattggcaggccatagcactc
acctgcgccgtctgctcctgcataatcttcttcttggtcgtcgctctttactcgctgtac
caggccaagcagtggaggcgcctgaaggtgaactacgaggctgatgtcgaggaactttca
gctcggctcagcctcatggcctcatccaacaacgagaaaggcgacccagaaaaccctaat
ttgggcacaattgatcccaactacctcaacaacagatgcgtgtatctagagaaactcctt
catggaaggaaagacaaaaggttgggttcggagagtggcaacgtctacatcgatgagaac
atgaaaacgtaa

DBGET integrated database retrieval system