KEGG   Nicrophorus vespilloides: 108565519Help
Entry
108565519         CDS       T04922                                 

Definition
(RefSeq) hexokinase type 2 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00010  Glycolysis / Gluconeogenesis
nvl00051  Fructose and mannose metabolism
nvl00052  Galactose metabolism
nvl00500  Starch and sucrose metabolism
nvl00520  Amino sugar and nucleotide sugar metabolism
nvl01100  Metabolic pathways
nvl01200  Carbon metabolism
Module
nvl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nvl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108565519
   00051 Fructose and mannose metabolism
    108565519
   00052 Galactose metabolism
    108565519
   00500 Starch and sucrose metabolism
    108565519
   00520 Amino sugar and nucleotide sugar metabolism
    108565519
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108565519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvl04131]
    108565519
Enzymes [BR:nvl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108565519
Membrane trafficking [BR:nvl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108565519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108565519
NCBI-ProteinID: XP_017780515
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
MRQKQEIRFCDLQQPLDDEYEISNEIQDRCKELILGDDQLKEVMKRLTDDINKGLGKKTH
ADAIVKCFVTYVQDLPNGTEKGKFLALDLGGTNFRVLLIELGDNHFEMKSKIFAIPQHIM
LGSGEQLFDHIADCLAKFMKEEKVQKEKLPLGFTFSFPLQQLGLTRGMLERWTKGFNCSG
VIGQDVVQLLKDAIARRGDIQITVCAILNDTTGTLMSCAWKNHDCKIGLIVGTGTNACYV
EKQKNAELFDGQDNGSGKVLINTEWGAFGDDGQLDFVRTEYDRDIDEHSINPGKQLHEKM
ISGMYMGELARLVLQKLTKEGLLFNGKGSDPLFTRQRFYTKYVSEIENEPHGTYNNCRQI
LEELGIKHASEQDCVNVRYVCECVSRRAAHLVSAGIACLLNKMDDPTVTVGIDGSVYRYH
PHFHNLMVAKISNLVNKHIKFNLMLSDDGSGRGAALVAAVASRK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaaaaacaggaaatccgcttctgcgatctgcagcaaccactcgacgatgaatac
gagatctccaatgagattcaggacagatgcaaggagctgattctcggtgacgatcagctg
aaggaggtgatgaagaggttgacggacgacatcaacaagggtttaggaaagaagacccac
gccgatgccatcgtcaagtgcttcgtcacgtacgtgcaggatcttcccaatggaacagaa
aagggaaaattccttgctcttgatttgggcggaacgaatttccgcgtgctgctgatcgag
ctgggcgataatcacttcgagatgaagtcgaagatcttcgccataccgcagcacatcatg
ctcggatccggggagcagttgttcgaccacatcgccgactgtctggcgaaattcatgaag
gaggagaaggtgcagaaggagaagctgccgctcggattcacgttcagctttccgctgcag
cagctcggattgacgcgcggcatgctcgagagatggacgaaggggttcaactgttccgga
gtcatcggacaggacgtcgtccagctgctgaaggacgccatagcgagacgaggcgacatt
cagataacagtgtgcgcgatcttgaacgacaccacaggcaccctcatgtcttgcgcttgg
aaaaatcatgattgcaaaattggtctcatcgtcggtaccggcacgaatgcgtgttacgtg
gaaaagcagaagaacgctgagctgttcgacggtcaggacaacggatcggggaaggtgctg
atcaacacggaatggggcgcgttcggagatgatggccaattggatttcgttcgcacggag
tacgatcgcgacattgacgagcattccatcaatcccggcaaacaattgcacgagaagatg
atttccggcatgtacatgggcgaattggcgcgtctggtgcttcagaagttgacgaaagaa
ggtctcctgttcaacggcaaaggctcggatccgctcttcaccagacagaggttctacacc
aagtacgtttcggagatcgagaacgaaccgcacggaacgtacaacaattgcaggcaaatc
ttggaggaattgggaatcaagcacgcttcggagcaggattgcgtgaacgtgcgttacgtg
tgcgagtgcgtgtcgagacgcgccgctcacctggtgtccgcgggcatagcctgcttgctc
aacaagatggatgaccccaccgtgaccgtcggcatcgatgggtccgtgtacaggtaccat
ccgcacttccacaaccttatggtcgccaagatctcgaacctcgtcaacaaacacataaag
ttcaacctgatgctctccgacgacggtagcggacgtggcgccgcgttggtggcggccgtc
gcgtcgcgcaaatga

DBGET integrated database retrieval system