KEGG   Nicrophorus vespilloides: 108566279Help
Entry
108566279         CDS       T04922                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00562  Inositol phosphate metabolism
nvl01100  Metabolic pathways
nvl04068  FoxO signaling pathway
nvl04070  Phosphatidylinositol signaling system
nvl04140  Autophagy - animal
nvl04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108566279
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108566279
   04070 Phosphatidylinositol signaling system
    108566279
   04150 mTOR signaling pathway
    108566279
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108566279
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nvl01009]
    108566279
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108566279
    3.1.3.48  protein-tyrosine-phosphatase
     108566279
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     108566279
Protein phosphatases and associated proteins [BR:nvl01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    108566279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VHS PTEN_C2 FYVE DSPc Y_phosphatase FYVE_2 Y_phosphatase3 PTPlike_phytase DUF3384
Motif
Other DBs
NCBI-GeneID: 108566279
NCBI-ProteinID: XP_017781576
LinkDB All DBs
Position
Unknown
AA seq 697 aa AA seqDB search
MANFNNMMFSNSIKGLISKKRNRYKQDGFDLDLTYIRHNIIAMGYPASNIEGKVIRNHID
DVVKLLDSKHKDHYKIYNLCSERSYDATKFHNRVKMFPFDDHNPPKIDLIRPFCVDVHEW
LTANSENVAAVHCKAGKGRTGTMICCYLLHSQIYETADDALSFYGNTRTQDKKGVTIPSQ
VRYIRYYESMIREHLVYSSVSLYVTELKLEPPPTLTSAQGGSLYFTISSANFKKKCKSIV
QEVRKGDVKCLTLKVDACVPITGDIKIELYSKSPLKKKQFQFWFNTFFVRDEWSGQTTAC
CTSPDVAAAAASSDLNGYSGQNGGGGGGGAATTANVGILHSQVPLSASNNCSSSSNTGET
LVLTLTKSELDNLNKKDKQNKTFSADFKIMLLLRRPSKNIWMPAQQEGMGQHVIQDSPSG
SSEGDSSDGDDDDEAWDSVANERGWTATIEHSNMFKSNFDKLLDKATSNLLMDEDWKSIL
DMCSQIRQNDVKPKQVFASLKKKLMHNNPNTSMYAITCLESMVKNCGAVFHEELLTKPNC
EMLHEVVKTTPHEPVRQKMLELLQAWNYAFRKHKSFAALKETMNLMKAEGFKFPAVKESD
AMFSVNSAPAWVDGEVCHRCRTAFNMLNRKHHCRNCGQVFCSSCTGNNVMLPDLGFEKDV
RVCNTCYEKVVKANSNAATKDAELEEYQKSSLAQQSQ
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggccaactttaacaacatgatgttctccaattcgatcaagggtctgatcagcaagaag
aggaaccgctacaaacaggacggtttcgacctggatctgacatatattcgacacaatatt
attgccatgggttacccggcgtccaatatcgagggcaaagtgatccggaatcacatagac
gacgtcgtcaagctgctcgactccaagcacaaggaccactataaaatctataatctgtgc
tcggagaggtcgtacgatgccaccaaatttcacaatcgagtaaagatgttcccgttcgac
gatcacaatccgcccaagatcgacctgatccgaccgttctgcgtggacgtccacgaatgg
ctgacggcaaactccgagaacgtcgcggctgttcactgcaaggcaggaaagggccgcacc
ggcacgatgatctgctgctacctgctgcacagccagatctacgagacggccgacgacgcg
ctcagcttctacggaaacacgaggacgcaggacaagaagggcgtgacgataccgagccag
gtgcggtacatccggtactacgagagcatgatccgtgagcacctcgtctacagttcggtc
agcctgtacgtgaccgaactgaagctggagccgccgccgacgctgacgagcgcgcaaggc
ggcagcctctacttcaccatctcgtcggcgaactttaagaagaagtgcaagagcatcgtg
caggaggtgcgcaaaggtgacgtgaagtgtttgacgctcaaagtggacgcgtgcgtgcct
ataaccggtgacatcaaaatcgaactctacagtaaatcgccgctcaagaagaagcagttt
cagttctggttcaacaccttcttcgtgcgcgacgagtggtccggccagacgacggcctgt
tgcacgtcacccgatgtcgccgctgccgccgcctcctccgacctcaacggttacagcgga
caaaacggaggaggaggaggaggtggagcagcgacaacagcgaacgttggcattctgcac
tcgcaggtgcctttgtctgcctccaacaactgtagcagcagcagcaacaccggcgagacc
ttagtcctcaccctgaccaaaagtgaactcgacaacctcaacaagaaagataaacagaac
aagacgtttagtgctgatttcaaaataatgctgctgctcaggcgaccgtcgaagaatatt
tggatgccggcgcagcaggaaggaatgggacagcacgtgatccaggactcgccgagcgga
agttcagagggtgacagcagcgacggcgacgatgacgacgaggcgtgggacagcgtggcg
aacgagcgtgggtggaccgcaacaatcgaacattccaacatgtttaagtcaaatttcgat
aagcttctggacaaagccaccagcaatctgctgatggacgaggactggaagtctattctg
gatatgtgcagtcagataagacagaacgatgtcaaaccgaaacaagtattcgcttccctg
aagaagaaactgatgcacaacaacccgaacacatccatgtatgcgatcacatgcttggag
agcatggtcaagaattgcggtgcggttttccatgaggagctgctcaccaaaccgaactgc
gagatgttgcacgaggtggtgaaaactacaccgcatgagccggtgcggcagaaaatgctg
gaactgttgcaagcgtggaattacgcgttccgcaaacacaaaagtttcgcagcgttgaag
gaaacgatgaatctgatgaaggcggagggattcaaatttccagcagtcaaagagtctgat
gccatgttcagcgtgaattctgcaccggcttgggtggacggcgaggtttgccatcgttgt
aggacggcattcaacatgttgaacaggaaacaccactgccggaattgcgggcaggttttc
tgcagttcctgcaccggaaacaacgtgatgctgccggatctcggtttcgagaaggacgtg
cgcgtctgcaacacttgctacgagaaagttgttaaagcgaactcgaacgccgccaccaaa
gacgctgaattggaggagtaccagaagagttcgctggcccagcagagtcag

DBGET integrated database retrieval system