KEGG   Nicrophorus vespilloides: 108567082Help
Entry
108567082         CDS       T04922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific-like isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108567082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nvl03036]
    108567082
Enzymes [BR:nvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108567082
Chromosome and associated proteins [BR:nvl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108567082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 108567082
NCBI-ProteinID: XP_017782817
LinkDB All DBs
Position
Unknown
AA seq 1338 aa AA seqDB search
MAQQLKLHSPAGAEPVLYTWPLTSGRGNDRHDGAIEIVETIRWVCEDLPELKLPMENNIL
TNYDTRSYDSMKALCDRFNKAIDSLVALEKGTSLPAQRLNKYPSRGLLRHILQQTYNQAV
TDPDKLNQYEPFSPEVYGETSYELISQMIDQIDITPEDIFIDLGSGVGQVVLQMAAATPC
KICLGIERAEVPSRYAESMNKNFRTWMKWYGKKFGEYKLMKGDFLMEEHREKINSATIVF
VNNFAFGPTVDHQLKERFADLKDGARIVSSKSFCPLNFRITDRNLSDIGTIMHVSEMSPL
RGSVSWTGKPVSYYLHIIDRTKLECYFQRLRNPKVKENEDSNNVRSSREKTRRDLTKQIH
DSSSDSDFYDQDGNYGLGPTTRRAWSDWCSNKGKSSQSEEEVTGKGKRQPKKLRRKISRG
KNQTTPAKPINKPRRGRVKKAKPKKAIKINGLDLLHSQTLLSTSPQANGKKLPPPPGCVD
QQLTALSTEMVHDELDIPQAPGDTPYSLQILLDMYRVQYMNMIDQFKSPDYKNNIEQLIA
EEKDRNQRLQSRAAQLEKQIKVLIDDSVALLKARMSELGINATSPVDLLAKAKEIVCRHK
DLQAKASKLQIQVGNLEEKQKALVIERKQEIAEKYGKPEVNRELSANMAEECILREISST
LSHRKKLHNQVSLLEGEVLSLEKSSEERKQAQALMARQQQIAPTKVSRKSRDYRARSQDW
PDVPDIAKIEEQNPEILAQKILEKGRMIEASKQLSSNSKLPQMNMPMKCPSSNQRTSSRT
SMPAPVPVAKRPKISNTPSSHPSPSHHQRPQEPPRIANFEDRLKSIITSVLNEDQQTRSK
SQQQQQPPPQHQQPQHQQPQPQHQPSQHQPSQHQQPQHQQPHHQQPQQQHTPSMYSPNQA
PTPVYNAPPTPHHQYNSYNQYMANTKHDERKYPKYNGNRCETIVRPAEEQAKVAQTHEGL
VVSMTENYVEPEPPRISPIQPRSSQPEQPDYTQISPAKLALRRHLSQEKLAAAQHHVFNP
PAESIVATRTIGDLMSGEIERTLEISNQSIINAAVDMSDIRTHHVINTNLPRPERVNVKV
PEPPKEPEAAPMRQVYSPISRPSSTEGLEGLAYINPHIKVNTHSVYMPPPPQQSPRQSQF
SPRTTVLYPTQARPSYEPYTPLPRADIKYHESYFTDIKPSMVEAESRSNFVPEGLAARVM
NGPHIKEEIDCERRYLQYHDIKTESTSTDCHYKRESPVIHGPIRNKAVSTYIPDAGHRNY
PRIHHSPPERAKTTLPMDAERKLLVEEIEVEEEGEESKWQDKISSGFDRLVAFASTELDK
RRRSTEGNDRTGSLYLFI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcagctgaagctgcactcccccgcaggggctgaacctgtgttatatacttgg
ccgttaacctcaggacgtggaaatgaccgtcatgatggagcaattgaaattgttgagacc
atcagatgggtgtgtgaggatttgcccgaacttaagttgcccatggaaaataatatactt
acaaattatgacacacgaagttatgatagcatgaaggcattatgtgataggtttaataaa
gccattgatagtctcgttgctttagaaaagggaacgtcactgccagcacaacgattaaat
aaatatcccagcagaggcctgcttaggcacatcttgcaacagacttacaatcaagccgtc
acagatccggacaaactaaatcaatacgaaccattttcacctgaggtttatggagaaaca
tcgtatgagctcatcagccaaatgatagatcaaattgatattacaccagaagacatattt
attgatttgggttctggcgtgggtcaagttgttctacaaatggctgcagcaacgccatgc
aaaatttgcttaggtattgaaagagctgaagtacctagccgatatgcagagtctatgaac
aagaacttccgtacgtggatgaagtggtacggaaagaagttcggggagtacaaactaatg
aagggagatttcctcatggaggaacatagagagaaaatcaattctgccaccatagtgttc
gtaaataattttgcctttggtcctactgtggaccaccaactgaaggagcgctttgctgat
ctgaaggacggcgccaggatcgtctcttctaaaagcttctgtccacttaactttcgaatt
actgatcgtaatctcagtgacatcggcacgataatgcatgtatcggaaatgtcaccgttg
cgtggttccgtctcctggacggggaagcccgtttcgtattaccttcacatcatcgataga
accaaattggaatgctatttccaaagattgcggaatcccaaggttaaggaaaacgaggat
tccaacaatgtgcggtcatcgcgagaaaaaaccaggagggacttgacgaaacagatacat
gattcttcttcggattcagatttctatgatcaagatggcaactacggattggggcctaca
actcgcagagcctggtcggattggtgttcaaacaagggcaagagcagccaatccgaagag
gaggttacgggcaagggcaagaggcaaccgaaaaaactgaggcggaagatttcgagagga
aaaaatcaaacgacgcccgctaagcccataaataaaccgcgtaggggaagagtaaagaaa
gccaagcccaaaaaggctattaagatcaacggcctggatttgcttcactcgcaaacgttg
ttgagtacttcaccacaagcaaatggtaagaaacttcctccacctccgggatgtgttgat
caacagctgactgctctgagcacggaaatggttcacgatgaattggacataccccaagct
cccggagatacgccctactctctgcagatcctattggatatgtatagagtacaatatatg
aacatgattgatcaattcaaatcaccggactataagaataacatcgagcagttaatcgcc
gaggagaaggatcggaatcaacgtttgcaaagcagagcggcgcaactagagaaacagatt
aaagtgctcatagacgacagcgtagctttgctgaaagctagaatgagcgaattgggtatt
aatgcaacttccccggtggacctattggcgaaggccaaggaaattgtttgtagacacaaa
gatctccaggcaaaagccagtaagttacaaatacaagtaggcaatttggaagagaagcag
aaggctttagtaattgagcggaaacaggaaattgcggagaaatatggtaaaccagaggtg
aatcgagaattgtctgcaaacatggcagaagagtgcatcttgcgcgagatttcatctact
ttgtcgcatagaaaaaagttgcacaaccaggtgagcctactggaaggcgaagttctatca
ttggagaaatcgagcgaggagagaaagcaagcgcaggcccttatggccaggcagcagcaa
atagcgcctaccaaagtatcccgtaaatccagggactacagagctaggtcacaggattgg
cctgatgtgccggatattgcaaagatcgaagagcagaatccggagattctcgcacaaaag
atcttggagaaaggtagaatgatagaagcgagtaaacaactttctagcaatagcaaacta
cctcagatgaatatgcctatgaagtgcccgtcgagtaatcaacgaacgtcgtcaagaaca
tcaatgcctgccccagtaccggtcgcgaaacgaccgaaaatcagtaatacaccatcgtcc
catccgtcaccttcacatcatcaaagaccacaagaaccaccaagaattgctaattttgaa
gaccgcctgaaaagtatcatcacgtctgttttgaatgaagaccaacaaacacggtcgaaa
tcacagcagcagcagcaaccgccaccgcaacatcagcaaccacaacatcaacaaccacaa
ccgcaacatcaaccatcgcaacatcagccatcccagcatcagcaaccgcaacatcaacaa
ccacatcatcaacaaccacaacagcaacatactccatccatgtatagtcctaatcaggca
ccgaccccagtttataatgcaccacccacccctcaccaccagtacaattcatacaaccag
tatatggcgaatacgaagcacgatgaacgaaagtaccctaagtacaatgggaatagatgc
gagacgatagtgaggcctgcagaagaacaggcaaaagttgctcaaacacacgaaggttta
gtagtcagcatgacggaaaactacgtagaacctgaaccccctaggatatcgccgatacag
ccgagaagttcacagcctgagcaaccggattacacgcagatatcgcccgcaaagctggca
ttaaggaggcacctatcccaagagaagttggctgctgcgcagcaccacgtattcaatccc
cccgcagaaagcatagttgctactagaacaataggtgatttgatgtccggcgaaatcgaa
aggacattggagatatcaaatcaatcgataataaatgccgccgttgatatgagcgacata
cgtactcatcatgtgattaacacaaacctgccacgacctgaaagggtcaacgtgaaggtg
cctgaacctccgaaggagcccgaggctgcccctatgagacaagtttacagtcccatttcg
aggccttcgtcgacagaaggcttagaaggtttagcctacataaatccccacattaaagtg
aacacgcattcagtgtacatgccgccaccccctcaacagtcaccaagacaatcacaattt
tcaccgcggacgacggtcttgtacccaacccaggcaagaccgtcctacgagccttacaca
ccgctgccaagagccgacataaaataccacgaatcgtattttactgacattaagccttca
atggtggaagccgagagtagaagcaattttgtacctgaaggactagctgccagggttatg
aacggacctcacatcaaagaggaaattgattgcgaacgtagatatttacaatatcatgat
ataaagactgaatcaacatcaaccgactgccattataaacgcgagtcacctgtgatacat
gggccgatcaggaacaaagccgtctcaacttacataccagatgcaggacatcgaaattat
ccgcgcatccatcattcaccgccagaacgagctaaaaccacactgccaatggacgctgaa
aggaagcttcttgtcgaagaaattgaagttgaagaggaaggcgaggagtcgaagtggcaa
gacaaaataagttcaggtttcgaccgattagtagcatttgcatcgacggaattagacaaa
cgtaggcgatcgacggagggtaatgacaggacgggaagcttatatctgtttatttga

DBGET integrated database retrieval system