KEGG   Nicrophorus vespilloides: 108567433Help
Entry
108567433         CDS       T04922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EHMT2 isoform X1
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108567433
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nvl03036]
    108567433
Enzymes [BR:nvl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108567433
Chromosome and associated proteins [BR:nvl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108567433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank_4 Ank SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 108567433
NCBI-ProteinID: XP_017783388
LinkDB All DBs
Position
Unknown
AA seq 923 aa AA seqDB search
MEEESSDSTPCNEEEGTFITKILGEMKTQFNNGSEENSQEEVQKVESEAVTEDTTAVTLG
FSKPRKRSKRVKVAIDVNVKRSTRRRSRDYNESILKTAIARKEKSYNESDKPQRLTRQLK
PTQKILDNIANAAASKHEKKKRVKGGDGEEKVVKVKSTRRRTKVVEQLVEIKEEIVESDT
KLNIELDTKPVLVPQMTATQLCVCSHETKYYVLVENRENVFCTAIDNISNKLIGCNNPVN
HKDSSMLRPSVRIPYGVFCSLHRSRMLNHNCCPVCGIFCTQGSFVQCENKHQYHRKCQNS
IDEALVCPHCGKPSPTTDIEIIMETSKPPVFLRTQQLSVKSIETSNVKRTNNRESSCESP
PMISVEDLKLYNETEMRESGQYSINDLLDCIKKSDYQEVAAILGSRSVDLNSFVECDKDE
TGTVLHYSARHGLLPIIHMLTIAEDDLDILDSEKNTALMVGVLHEQNDVVKYLTKAGASI
IAKGMDGMTALHLAAKCGNLEACEILLSTAAHIKNYIDIADDGGWTPLVWSCEHNHVDIV
KYLLSEKANPLLSDVEQNVALHWAAFSGSSKIVEMILNFGGEVNVINSHGDSPLHIAARQ
DNYNCVLVLLARGAKIDVVNKADETPIECCPENSKSYEALILNIRLQSYIQVDNSTSNCL
SNDISEGKERNAISCINSVDDETPPRDYCYVTKNCIMPDIQIDSDTLLVSCSCSGICQSS
CDCYKHSNVHMGDSLANDLTGHKVIFECSPSCSCSDEVCTNRVVQKGSKVKFQLFRTRSK
GWGVKTLNVIKRGTFVSEYVGQIINEEQADSREDDTYLFDLDNKFQGTERFSIDAKFYGN
VSRFMNHNCRPNLLPIRVFTDHHDVKFPRISLFAKCDIRKNEELSFDYGEKFWAIKKNYF
ACKCGSDNCIYSERQVKNSVQKC
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaatcttcagactccaccccatgcaatgaggaggaaggtacctttataacg
aaaattttaggagagatgaagacacagtttaacaacggctccgaagaaaactcgcaggag
gaagtgcaaaaggtggaatcagaggcagtgacggaagatacaactgcggtgacactcgga
ttctccaagccgcggaagaggtcgaagcgggtcaaagtggcaatcgacgtaaacgtgaag
aggtccacaagacgccgaagccgcgattacaatgagtctattctgaaaacggcgatagct
cgcaaggagaagtcttacaatgagtctgataagccccagaggctgaccaggcaattaaaa
cccacccagaagatcctggacaatatagccaatgcagctgcatcaaaacatgagaagaag
aagagggttaagggaggtgatggagaagagaaggttgttaaagttaagtctaccagaagg
aggactaaggttgttgagcaactggtcgagatcaaggaggaaatagtggaaagcgacacc
aaattgaatattgaattggatactaaaccagtgctagtcccacagatgacagcaacccag
ttatgtgtttgcagtcatgaaaccaagtattatgttttggttgaaaacagagagaatgtt
ttctgtactgcaatagataatataagtaataaactgattggttgcaataatcctgtcaac
cacaaagactcatcaatgttaaggccttctgtccgtattccttatggagtcttctgctca
ttacatagaagccgaatgctgaaccataattgttgtccagtttgtggtatattctgtaca
cagggaagttttgtgcaatgtgagaacaaacatcagtaccacagaaaatgtcagaacagt
atagatgaagcactggtatgccctcattgtggcaaaccatcacccacaacagatatagag
attattatggaaacgtcgaaacctcccgttttcttaaggacgcaacaattgtcggtgaaa
agtatagaaactagtaatgttaaaaggactaataacagggagagcagttgcgagtcacca
ccgatgatctccgtcgaggatctgaagttgtataatgagacggagatgagggaatccggt
caatatagtattaatgatttgttagattgtattaagaagagcgattaccaagaagttgcg
gctatattaggttcaagaagtgtagatttgaacagtttcgtggaatgcgataaagatgaa
actggtacagttttacattactctgctaggcacggattgctgcctataattcatatgctc
acaatagctgaagatgatttggatattttggatagcgaaaagaatactgcgttgatggtt
ggtgtacttcatgaacagaacgacgtcgttaaataccttacgaaagctggtgccagtatt
attgctaagggtatggatgggatgacagctttgcatttagcagcgaaatgtggtaatttg
gaagcttgcgaaatcctcttgtcaactgcagcgcatatcaaaaattacatcgacatagca
gatgacggaggctggacccctttggtgtggagctgtgagcataatcacgtcgatattgtg
aaatatctcttaagtgaaaaagcgaatccactcttgagcgatgttgagcagaacgtcgca
ctacactgggctgcattcagtggtagctcgaaaatcgtggaaatgattttgaattttggt
ggcgaagtgaatgtgatcaattcacatggagatagcccattacatatagcagccaggcag
gacaactacaactgtgtgctagttctattggctcgcggtgctaaaatagatgttgtcaat
aaggcggatgagactccaatcgaatgctgtcctgagaatagcaaaagttacgaggcactc
atattgaatatccgtctacagagttacatccaagtagacaacagtacttccaattgttta
tcgaatgatatatcggaaggtaaggagcgaaatgccattagctgcattaacagtgtcgat
gatgaaacgccgcctcgtgattactgttacgtaacgaagaactgcataatgcccgatatt
cagatcgattctgacaccttactggtaagttgttcgtgtagtggaatatgccaaagtagt
tgtgattgttacaagcatagcaatgtgcacatgggcgattctttggctaacgatttaacc
ggtcataaggtaatatttgaatgcagtccttcctgctcctgttcagatgaagtttgcaca
aatcgtgtagtgcagaaaggaagcaaagttaagttccaactgttcaggaccaggtcgaag
ggctggggcgtgaaaactctgaacgtcattaagcgaggaaccttcgtttcggaatacgtc
ggtcagattataaacgaagaacaggccgattctcgtgaagacgacacgtacttatttgat
cttgacaataagtttcagggtacggaaaggttctcgatagatgcgaagttttatgggaac
gtgtctcgtttcatgaaccacaactgcagaccgaacttgttgcctataagggtcttcaca
gatcatcatgacgttaagtttccgaggatttcgctgttcgccaaatgcgatatccggaag
aacgaagagttgagtttcgattatggagaaaagttctgggcaataaaaaaaaactatttc
gcatgtaaatgcggtagcgacaattgcatttattccgaacgtcaagttaagaattccgtc
caaaaatgttaa

DBGET integrated database retrieval system