KEGG   Nicrophorus vespilloides: 108567530Help
Entry
108567530         CDS       T04922                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
nvl  Nicrophorus vespilloides
Pathway
nvl00052  Galactose metabolism
nvl00500  Starch and sucrose metabolism
nvl01100  Metabolic pathways
nvl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108567530
   00500 Starch and sucrose metabolism
    108567530
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    108567530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvl04147]
    108567530
Enzymes [BR:nvl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108567530
Exosome [BR:nvl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108567530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 108567530
NCBI-ProteinID: XP_017783547
LinkDB All DBs
Position
Unknown
AA seq 1022 aa AA seqDB search
MTGIRRLLHSFRARRVARRLARTESVSFNAFCNEGPVDQYPTTKESSLCKPPKFDHGNHN
ESAEFNPRDVTILECSRPCIVTVLLLLLLLAVFLILPTIYLLYCFGVLHVNQQKHLTHTF
ALKEKDHYAPKLHDLFKINRIPAQPYKILPPPPPPNQSQCGIPLEARFDCYPEDGATKEK
CEARGCCWFPRSAQSLKRIKRIRESVDVSYCFYPKNYESYKFVNVSKTDFGLIAFLKRNY
RSAYPDDVETVKMIVKLETEDRLRIKILDPLHVRYEPPYPSVPIVDKAPTDFSYIFKYNI
SASGFKILRRSDEAIIFDAMNLQTMIFADQFIQFSSLLPSKNIYGLGEHRSSMKLSTEWK
RFTMFNHDSIPTEDLNLYGMHPFYMNVENSTKAHGVFLLNSNAMEVILQPYPAITYRTIG
GILDFYIVLGPSPRDVVRQYTEIIGRPFMPPYWGLGFHLCRFGYKTLNETRKVMQRTIDA
GIPLDTQWNDLDYMNNSNDFTYDKTNFKNLPKFVEELHKNGMHYIPLIDPGISASEVKGS
YVPFDKGLAMDIFVKNSSGLPFVGKVWNRATTVWPDFTNPNSVDYWTSMLKILHDSVQFD
GAWIDMNEPSNFLSGSFDGCPNNHLEHPPYLPAIDGGMLFYKTICMSANHTIGLHYDVHN
LYGFSEAIITNFALAEIRGKRPMIISRSTFPGHGKYAGHWSGDVYSKWTDMRYSIPQLLS
FSLFGIPLMGADICGFNGNATATLCNRWMQLGAFYPFSRNHNTDDGIEQDPVALGPDVIE
SSKKALSIRYSMLPYLYTLFWAAHTRGDTVARPLFFEFPNDWITYDIDKQFLWGSALMII
PVLTENQVSVSCYVPAATWYDFYTFKMLNVSEGKTMEMAAPLDTIPLLIRGGNIIPQQSA
LQTTTASRMTKFQLLVATNESQKAFGELYWDDGDSLNSAEERKYCLLEFTMDGQKLTSDV
IHWGFEAPPNLGVVKVLGISAVTKVYVNKVDQPFDYNTINKYLLIKDLNVDLKKPMEVTW
TY
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgactggaatcagaaggctcctgcattcgttcagggctcgaagggtcgccaggagattg
gcccgcacagaatctgtatccttcaatgcattctgcaatgagggccctgttgatcagtac
cccacaacaaaggaatcctctttgtgcaaaccgcccaagtttgatcatggaaaccataat
gaatctgcagagtttaatccgagagatgtgaccatcttggagtgcagccgtccctgcata
gtcacagtactgctgctccttctgctcttggctgtgtttctcattctccctacaatatat
ttgctctattgctttggggtgcttcacgtcaatcagcagaagcatttgacgcatactttt
gcgctgaaagagaaggatcactatgcgcccaagctccacgacctatttaagatcaacagg
attcccgctcaaccgtataagattttaccaccgccgcctcctccgaaccaatcgcagtgt
ggcataccgctggaggccagattcgattgttacccggaggatggggcaacgaaggagaaa
tgcgaggcgcgcggatgctgctggtttcccaggagcgctcagtcgctgaagaggatcaaa
cggattcgagagtccgtcgatgtctcgtattgcttctatccgaaaaactatgagagctac
aagttcgtgaacgtttccaagacggatttcgggttaatcgcgttcctcaagaggaactac
cgtagtgcgtatcccgacgacgtcgagaccgtcaagatgattgtcaaattggagactgag
gatcgtcttcgcatcaagattttagatccgctgcacgtgagatacgagcctccgtatcca
tcggtaccgatcgtggacaaagcgccgaccgatttctcgtacatattcaaatacaacatc
tccgcatccggcttcaagattctgcggagatccgacgaggccataatattcgatgcgatg
aacttgcagacgatgattttcgccgaccagttcatacagttcagttcgctgctgccgagc
aaaaatatctacggtctgggcgagcacagatcgtcgatgaagctatccacggaatggaag
agattcacgatgttcaaccatgattcaatcccaaccgaggacctcaatttgtacggaatg
catcctttctacatgaacgtggaaaactcgacaaaggcgcacggagtttttctattgaac
agcaacgcgatggaggttattcttcagccgtatcctgctataacgtacaggactattgga
ggaatcttggatttctacatagttttaggtccgagtccgcgcgatgtcgtccgacaatac
acggagatcatcggaagaccattcatgccgccctactggggccttggtttccatctctgc
agatttggatacaaaactttaaatgaaacgcgtaaagtaatgcagagaaccatcgatgct
ggaattcctttggatacgcaatggaacgatctggattacatgaacaacagcaacgatttc
acttacgacaaaaccaatttcaagaatctgcccaaattcgtggaggaattgcacaaaaac
ggaatgcattacattcctttgattgatcccggaattagcgcgagcgaagtcaaaggaagc
tacgtcccgttcgataagggtcttgccatggacatattcgtgaagaactcttcgggttta
ccattcgtgggaaaagtttggaatagggctacaactgtttggcctgacttcacgaatcca
aattctgttgattactggacgtccatgctgaagatacttcacgattccgtacagttcgat
ggagcttggatcgatatgaacgagccgtccaatttcctctccggctcattcgacggatgt
ccgaacaatcatctcgagcatccgccctaccttccagcaattgacggtggaatgctcttt
tacaagaccatctgcatgtctgcgaatcacacaatcggactccactacgacgtacacaac
ctatacggatttagcgaagcgatcatcaccaacttcgcattggccgagatcagaggcaaa
agaccaatgatcatttcccgatccacgttccctggtcacggaaaatacgctggacattgg
agcggagacgtttactcaaagtggacggacatgcgatattccattcctcaactattgagc
ttcagtctgtttggaataccattgatgggagcagacatttgcggattcaatggaaatgcg
acggcgacattatgcaatcgttggatgcaattgggcgctttctatccattttccagaaac
cataacactgatgatggaattgaacaagacccggtcgctctgggtccggacgtaatcgag
tcatcgaagaaagctttatcaattaggtactcgatgttgccgtacttgtacacgctcttc
tgggccgctcacactagaggtgataccgtcgctcgaccactcttcttcgaatttcctaat
gattggataacttatgatattgataagcaattcctgtggggttctgcgctgatgatcatt
cccgtcttgactgagaatcaagtgagcgtgtcgtgttatgtgcctgctgcgacttggtac
gatttctacaccttcaaaatgctgaacgtgagcgaaggaaagaccatggaaatggcagca
ccattagataccattccgcttctgatccgtggcggcaacataattcctcagcaatcggcg
ctccaaaccacgactgcctcaagaatgaccaaatttcagcttcttgtagcgacaaacgag
agtcagaaggctttcggtgaactgtactgggacgatggtgattcgttgaattcggccgag
gaacgaaaatattgcttgttggagttcaccatggacgggcagaagttgacatcggatgtc
atccattggggattcgaggcaccgcccaatctgggcgtggtcaaggttttgggtatatcc
gccgtgacgaaggtatacgtgaacaaggtggaccaaccgttcgattacaacaccatcaac
aagtatttgttgatcaaggacttgaatgtagacttaaagaagcccatggaagttacatgg
acatattag

DBGET integrated database retrieval system