KEGG   Natrinema versiforme: FEJ81_21855Help
Entry
FEJ81_21855       CDS       T05974                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
nvr  Natrinema versiforme
Pathway
nvr00040  Pentose and glucuronate interconversions
nvr00051  Fructose and mannose metabolism
nvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FEJ81_21855
   00051 Fructose and mannose metabolism
    FEJ81_21855
Enzymes [BR:nvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     FEJ81_21855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: QCS44930
UniProt: A0A4P8WN67
LinkDB All DBs
Position
pNVE414:complement(187351..188376)
Genome map
AA seq 341 aa AA seqDB search
MRAAELVGAKLFELRERERPSPGESEVLVEVSDVGICGSDVHWYEHGRMGDRVVDEPLVL
GHESAGTVVETGAAVDGLAVGDAVTVEPGVPCGECEHCRHGAYNLCPDVAFMATPGTNGA
FREYVAWPAEYVYALPDSVPTREGALCEPLSVGVHAVRRAEIGVGDSVLVMGAGPIGLLT
ADAARAAGAGDVAVVDVVESKLDRAVDRGADLAVDSREADVTAAVREAFGGGVDAAIEAT
GAPPAIEATLDVPRAGGTAVLVGLAPEAEVPVDTFELVRRQLDVRGSYRFANTYPTAISM
LDCGVVDAAGIIDFEAPLDRIGDAFERAAEPDVVKGVISVD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggcggagctcgtcggggcgaagctgttcgaactgcgcgaacgggagcgaccg
tcgcccggcgagtccgaggtgctcgtcgaggtgagcgacgtgggaatttgcggctcggac
gtccactggtacgagcacggccgtatgggcgaccgcgtcgtcgacgagccgctggtgctc
ggacacgagagtgcgggcaccgtcgtcgagacgggggcggccgtcgacggcctcgctgtc
ggcgacgcagtcaccgtcgagcccggcgtcccctgcggggagtgtgagcactgccggcac
ggcgcgtacaacctctgtccggacgtggcgttcatggcgacgcccgggacgaacggcgcg
ttccgggagtacgtcgcctggccggccgagtacgtgtatgccctccccgactcggtaccg
acccgggagggcgcactctgtgagccgctgagcgtcggtgtccacgccgtccgccgggcg
gagataggcgtgggcgactcggtgctagtcatgggcgcggggccgatagggctcctcacg
gccgacgccgcgcgggcggccggcgcgggagatgtcgcggtcgtcgacgtcgtcgagtcg
aagctcgaccgggccgtggaccgcggggccgatctcgcggtcgacagccgcgaggcggac
gtgaccgcggcggtccgggaggcgttcgggggaggcgtcgacgccgcgatagaggcgacc
ggtgcaccgcccgccatcgaagcgacactcgacgtgccgcgggccggcggcaccgcagtg
ctcgtcggcctcgcccccgaggctgaggtgccggtcgacacgttcgagttggtccgcagg
cagctggatgtccgcgggagctaccgcttcgcgaatacgtacccgaccgcgatatccatg
ctcgactgcggcgtcgtcgacgcagcggggatcatcgacttcgaggccccgctcgatcgg
atcggtgacgcgttcgagcgggccgcggagccggacgttgtcaaaggcgtgatctcagtc
gactga

DBGET integrated database retrieval system