KEGG   Nitrosococcus watsonii: Nwat_0124Help
Entry
Nwat_0124         CDS       T01266                                 

Definition
(GenBank) (Glutamate--ammonia-ligase) adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Nwat_0124
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     Nwat_0124
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     Nwat_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: ADJ27102
UniProt: D8K8A7
LinkDB All DBs
Position
130925..133822
Genome map
AA seq 965 aa AA seqDB search
MNWQANIHKLPALLQGRLENDLARFQEALEQKDLEAVLKVKTLETLYLVWGASEFVATTC
IRWPSLLLDLQGSGDLFRAYEPNHYAKNLAQQLTDISTETELMIALRRFRQREMVRIIWR
DLAGWASLDEVFRELSQLAEACLNRALACLHYWQSEALGTPYGAVSGKPQSMVVLGMGKL
GARELNLSSDIDLIFAYPESGETRGAQRTLSNEEYFIRLARRLIRVLDERTEEGFVFRVD
MRLRPDGDSGPLVTSFTAMENYYQNQGRDWERYAMIKARVVAGDCQAGTHLIAMLRPFSY
RRYLDFGAIESLRGMKAMITQELRRQGIEANIKLGPGGIREIEFIGQSFQLIRGGREPAL
QERGILRVLALLAERDHLPYYAKEELCTAYIFLRRVEHRLQAYRDEQTHYLPTSAEGRAR
LAFAMGYGDWGAFASALEEHRRRVQEHFEQLFAAPHMDITDQMAQEKRLAEVWSGGELQE
ASLAVLSAAGYRAPEEAVQTLMYLRQSYTVRTLSAQARIRLDQLMPLLLGAVGRAEHPEQ
CLQRVIILLETVAQRTAYLALLAEYPMALSQLVKLCAASPLIARQLTRYPLLLDELLDPR
SLYRVLDYASLADDLERSLGTIPEDDLEQQMELLRHFCQRQTLRVAAADVTGVLPLMKVG
DHLTYLAEVILKKCLELSWRHLTRRHGRLPSSTGEQPEESGFAVIGYGKLGGYELGYGSD
LDLVFLHSAKLGDPPTEGKKPLDPVVFYSRLGQRLIHILQTSTPSGKLYEVDTRLRPSGA
SGFLVSGLDAYRDYQCGQAWTWEHQALVRARFVAGDARLGAAFTAMRREILGRRRDPVKL
REEVRQMRAKMRNQLDRSQRGWFDLKQGRGGIADIEFMVQYGVLAWAHAYPQLLEYPDNI
RILEGFAQAGLLASEESLLLADAYRAYRAAANRLSLQTHEARVEEGQFRQERIAVQRLWS
ALLEE
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgaactggcaagccaatattcataagctaccggcccttctccaggggcggcttgaaaac
gatttggcacgttttcaggaagcgttagagcagaaggatctggaagcggtacttaaagta
aaaacacttgaaacgctttatttagtttggggagcaagtgagtttgtagcaaccacctgc
attcgttggccttctttgttgttggatttgcaaggaagcggtgatctctttcgtgcttac
gaaccaaatcattatgctaaaaacctagctcaacagctcactgatatttctactgaaacg
gagctgatgattgccttacggcgctttcgccagcgagagatggtacgtattatttggcgt
gatttggctggctgggccagccttgatgaggtttttagggaactttcacaactggcggag
gcgtgtcttaaccgcgccttggcttgtttacactattggcaaagtgaggcattaggcact
ccttatggagctgtctctggtaaaccccaatccatggtagtgctgggtatgggcaaattg
ggggcgagggaacttaacctctcctcggatatcgaccttatttttgcctatcctgagtct
ggggaaacccgcggcgcgcagcggaccttgagcaacgaggaatatttcattcgcctagct
cgacgcttaatccgggttcttgatgagcgcacggaagagggattcgtgtttcgggttgat
atgcgtttgcgccctgatggggactctggtcccctggtaacaagtttcactgccatggaa
aattactaccaaaatcaaggccgtgactgggagcggtatgccatgatcaaagcccgagtg
gtggccggtgactgtcaggcgggaacgcatttaatagcgatgcttcggcctttctcttat
cgtcgttacctagattttggcgccattgagtctttgcgtggtatgaaggcgatgatcact
caggaactgcggcggcagggaatcgaagctaatataaaactaggccctggagggattcgc
gagattgaatttattggccaatcttttcagttgatccgtggaggacgtgaaccggctctt
caggagcgggggattctgcgggtgctagcgctgttagcggagagagaccatctaccctac
tatgctaaagaagaattatgcaccgcctatatatttttgcgccgggtcgagcatcgtctc
caagcttaccgggatgaacaaactcactatttgccaacttcagcagaagggcgtgctcgc
ttggcctttgctatgggttacggggactggggggcatttgctagcgcccttgaagagcat
cggcgccgggtgcaagagcattttgagcagttatttgctgcgcctcatatggatattacc
gatcagatggcccaggagaagaggcttgccgaagtttggtcagggggggagttacaggag
gcgagtctagcggttttaagtgcggccgggtaccgcgccccagaagaggcagtgcagaca
ctgatgtatctacgccaatcttatacggtgcgcactctcagcgctcaggcccgaattcgt
cttgatcagttgatgcccctgttgctaggggcggttggccgcgccgaacatccagagcag
tgtctgcagcgggtaataatattattggaaaccgtggctcagcgcaccgcttatttagct
ctattggcagaatatcccatggccttatcccagctcgtgaagctatgcgcagccagcccc
ttgatcgcccgtcaactgacccgttatcccttgctattggatgaactgctggatccccgt
tccctgtatcgggtgttggattatgcttccttagctgatgatctggagcggtcgctagga
actattccagaggatgatttggagcaacaaatggaattactgcgccacttttgccagcgc
cagacattgcgcgttgcggcggctgatgtcacgggggtgttgcctctgatgaaagtaggt
gatcacttaacttatttggcggaggtaatcctaaaaaaatgcctggaacttagttggcgg
catttgactcgccgccatggccggcttccaagcagcaccggagagcaaccggaagagtct
ggctttgccgttattggctatgggaagttgggaggctatgagttaggctatggttccgat
ctggatctggtttttcttcatagcgctaaactgggcgatcctcccacggaggggaaaaaa
ccgcttgaccctgtggtattttatagtcgtttaggacagcgtctcatccatatcttacaa
acgtcgactccttccggaaaactatatgaagttgatactcgcctgcgtccaagcggtgct
tccggcttcctggttagtggcctggatgcctatcgggattatcagtgcgggcaagcttgg
acttgggagcatcaagccttggttcgggcccgctttgtagcgggtgacgcaaggcttggc
gccgcctttaccgctatgcggcgggagattttggggcggcggcgagatccagtaaagcta
cgggaggaggtccgccagatgcgggctaagatgcggaaccaactggatcgcagccagcgg
ggctggttcgaccttaagcagggcaggggtggtattgctgatatagaatttatggtccaa
tatggtgtgcttgcttgggcccatgcttatcctcagctgctagagtatccggacaatatt
cgaattctggaaggttttgctcaggcggggctattggcatcagaagaaagcctgctgcta
gcggatgcttatcgtgcctatcgggcagcggccaaccggctcagtttgcagacccatgaa
gcccgggtggaggaggggcaatttcgccaggagcgtattgccgttcagcggttatggtcg
gctttactagaagaataa

DBGET integrated database retrieval system