KEGG   Nitrosococcus watsonii: Nwat_0871Help
Entry
Nwat_0871         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00473  D-Alanine metabolism
nwa00550  Peptidoglycan biosynthesis
nwa01100  Metabolic pathways
nwa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Nwat_0871
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nwat_0871
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Nwat_0871
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nwa01011]
    Nwat_0871
Enzymes [BR:nwa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Nwat_0871
Peptidoglycan biosynthesis and degradation proteins [BR:nwa01011]
 Precursor biosynthesis
  Amino acid ligase
   Nwat_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp_3 ATP-grasp_4 GSP_synth TTL
Motif
Other DBs
NCBI-ProteinID: ADJ27817
UniProt: D8K4C0
LinkDB All DBs
Position
904396..905490
Genome map
AA seq 364 aa AA seqDB search
MPINREPLFSHITVILGDPRLPDESKIDNCFSIEDLEAIDRAKEALGELSDYQFTYLDNH
SALLPQLIANPPNFVLNFCDTGYKNQAQQELHIPALLEMLGIPYSGAGPTCLGLCYDKSL
VRSVAKTHGVPVPAETFVHGNDLNGAILKDFPALIKPNRGDGSVGITENSLVYDEPQAHA
YINKLAMEFPSCDLLIQEFLPGDEYSVGLLGNPSSGFKILPILKVDYSRLAAHRLPPILA
YASKVDPASPYWTDIKYGKAAIDEGLRQRLVGYCRLLFERLGCRDYARFDFRADAQGEVK
LLEVNPNPAWCWDGKLNLMVGFAGYRYGELLEWILQAAQARYTKKQGIFSGEPASLKIGH
AADR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcaatagagagccgcttttctcccatatcacggtaattctaggcgatccgcgc
ctaccggatgagtctaaaatcgataattgctttagtatcgaagacttagaagctatcgac
agggctaaggaggccctgggagagctgagtgattaccagttcacttacttagataaccat
tcggcgttgctgccccagcttatcgctaatcccccgaattttgtcctcaatttttgcgat
actggctataaaaaccaagctcagcaagaactccatatcccggcgctgctggaaatgctg
ggaatcccctatagcggcgcgggacctacttgtcttggactatgctatgacaaatccctg
gtgcggtcagtggcgaaaacccatggtgttcccgtgcctgccgaaacctttgtccacggc
aatgaccttaatggagcgatacttaaagatttccctgccttaattaaacctaaccgagga
gatggcagtgtgggaatcacggaaaattccctggtgtatgatgaaccgcaagcccacgct
tatatcaataagctggctatggaatttcccagctgcgatctgctcatccaagaatttttg
cctggcgatgaatatagcgtgggcttacttggtaatccatcttctggctttaagatattg
cctattttgaaagtggactatagcaggctagcggcgcaccgcttgccccccatcctcgcc
tatgcctccaaggttgatcctgcctcgccttattggacggatatcaaatacggtaaagcc
gctatagacgagggcctgcgccagcgcctggtaggttattgcaggctgctgttcgagcgg
ttgggctgccgggattatgcccggttcgattttcgcgccgatgcccagggcgaagttaaa
ctgctggaagtaaatcctaatcctgcctggtgttgggatggcaagttaaacttgatggtg
ggatttgctgggtaccgttatggagagttattagagtggattctccaagcggctcaggct
cgatacactaagaagcaaggtatattttcaggggagccagcctccttaaagattggacac
gcagctgacagatag

DBGET integrated database retrieval system