KEGG   Nitrosococcus watsonii: Nwat_1346Help
Entry
Nwat_1346         CDS       T01266                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00061  Fatty acid biosynthesis
nwa00780  Biotin metabolism
nwa01100  Metabolic pathways
nwa01130  Biosynthesis of antibiotics
nwa01212  Fatty acid metabolism
Module
nwa_M00083  Fatty acid biosynthesis, elongation
nwa_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Nwat_1346
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Nwat_1346
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Nwat_1346
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nwa01004]
    Nwat_1346
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Nwat_1346
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Nwat_1346
Lipid biosynthesis proteins [BR:nwa01004]
 Fatty acid synthase
  Component type
   Nwat_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: ADJ28264
UniProt: D8K5T7
LinkDB All DBs
Position
complement(1466586..1467365)
Genome map
AA seq 259 aa AA seqDB search
MGFLADKKALIVGIASPRSIAWGIAQAMKREGAELALTYQNEKLQGRVEKLAIQCDTDIT
LPCDVSNDEQIEELFTHLDDYWDHVDIIVHSVAFAPRDQLQGDYLENVTREGFRTAHDIS
SYSFAALAKAGRTMMHGRNGALLTLSYLGAERTIPNYNVMGVAKASLEANVRYMATALGS
EGIRVNAVSAGPIKTLAAAGIDDFNKFLTYSERNTPLKRNVTTEEVGNAAAFLCSDLASG
ITGEILYVDGGYHIIGMGE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctagcagataaaaaagctcttattgtaggtattgccagcccccgctccatt
gcctggggaattgcccaagcaatgaaacgagaaggcgcggaattggcgctgacctatcaa
aatgaaaaacttcaggggcgcgttgaaaagctggccatccagtgcgataccgatatcacc
ctgccctgcgatgttagcaacgacgaacaaatcgaggagctgtttacccatttagacgat
tattgggatcatgtggatatcattgtccactcggtggcctttgcaccccgggatcaattg
caaggagactacctggaaaatgtcacccgggaaggtttccggactgcccacgacatcagc
tcctacagctttgccgccctcgccaaagcgggccggaccatgatgcacggccgcaatggc
gccctcctcacgctcagctacctgggcgcggaacggaccatccctaactataatgtcatg
ggggtagccaaagccagtctcgaggccaatgtacgctatatggccaccgccctcgggtcc
gagggaatccgggttaatgccgtctccgccggtcccatcaaaacgttagccgcggcaggt
attgacgatttcaataaatttctgacttattccgagcgcaatacgcccctcaaacgcaac
gtcactacggaggaagtcggcaatgcagcggcttttctgtgctccgatttagcctccggc
attaccggcgaaatcctttatgtggacgggggctatcatatcattgggatgggcgaatag

DBGET integrated database retrieval system