KEGG   Nitrosococcus watsonii: Nwat_1493Help
Entry
Nwat_1493         CDS       T01266                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
nwa  Nitrosococcus watsonii
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Nwat_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Rrf2 Viral_Beta_CD
Motif
Other DBs
NCBI-ProteinID: ADJ28399
UniProt: D8K672
LinkDB All DBs
Position
complement(1633412..1634779)
Genome map
AA seq 455 aa AA seqDB search
MATLWQKTKVRLKQALRSPERRGEDRWRAFLRQKAKFVYAVSREFFKGDLTLQATSLVYT
TLLSLAPLLAVSFSVLKAFGIHNEIEPVLHHFLLPLGPRGEEITTKIIQYVENLKVGVLG
SVGVGLLFYTVISLIQKVEGAFNHVWRIKAERPFARRFSDYLSVLLIGPVLVFSAVGATA
SVMQTSFIQTLLDFELLGKTLVVMSKLLPYLLVIAGFTFIYLFLPNTKVRLGSALVGGAV
AGILWETIGILFAFFVTTSTKYDAIYSSFAIVILFMIWLYISWLVLLVGAQVAYYHQNPR
MIGLAQQDPLLLSNRLKERVGLLILARVGEAFHQGCPPPTLENLAKHFSLPSYLIEDIIE
SLKRARLVTATGAEPPGYLLSKDPATVTVRKVLAIIRQAEEQKFPLESISLKSPAVDGIM
EKIEQALDQAMKGATLKDLIGDKREASTESSADFI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttgtggcaaaaaaccaaagtgcgcctgaagcaggcgttgcgatctcctgaa
aggagaggggaagatcgttggcgagcttttttacggcaaaaagcgaagtttgtatatgcg
gtgtcgcgggaattttttaagggtgatctcactttgcaggcaaccagcttagtttatacg
acgctgctttctctagcaccgttactggcggtcagtttttccgtactcaaggcttttggt
atccacaatgaaatagagccagtgttacatcattttttactgcctttaggaccacggggc
gaagaaattaccactaaaattatccagtatgtagaaaacttaaaggtgggggtgttggga
tcggtgggtgtagggctgcttttttatacagttatttctcttatccagaaagttgaaggc
gcttttaatcatgtctggcggattaaggcggagcgtccctttgcacgccgttttagcgat
tacctaagtgtactcctaattggacccgtgctggtcttttcggcagtgggagcgactgcc
tcggtgatgcaaaccagttttattcagactctcttggattttgagcttttgggtaaaacg
ctggtggtgatgagcaaattactgccttacctattagtgattgctggctttacctttatt
tatctctttctccctaatactaaagtgagactaggaagcgctttggtagggggagcggtg
gccggaatattatgggagaccatcggaattcttttcgctttttttgtcaccacttcgact
aaatacgatgccatttattccagttttgccatcgtgattctctttatgatttggctttat
attagttggcttgttcttttagtgggggcccaggtggcttattatcaccaaaatcctcgc
atgataggcttggcgcagcaagatcccctgctcttaagcaatcgccttaaagagcgggta
gggttacttatcctcgcgcgggtaggagaagcattccatcaaggctgccctccgcctacg
ctagagaatttagctaagcattttagcctgcctagttatttaatcgaggacattatagaa
tctttgaagcgcgctcgccttgtaacagcaactggtgctgaacctccaggttatttgctg
agcaaagatccggctaccgttaccgtacgaaaagtgctagctatcattcggcaggccgaa
gaacaaaaatttccccttgaatcgatttcccttaaatcgcctgcggtggatgggataatg
gaaaaaattgagcaggctttagatcaagcgatgaaaggggctaccttaaaagatttaata
ggggataaacgggaggctagcacggagtccagcgctgattttatctaa

DBGET integrated database retrieval system