KEGG   Nitrosococcus watsonii: Nwat_2773Help
Entry
Nwat_2773         CDS       T01266                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00630  Glyoxylate and dicarboxylate metabolism
nwa00710  Carbon fixation in photosynthetic organisms
nwa01100  Metabolic pathways
nwa01120  Microbial metabolism in diverse environments
nwa01200  Carbon metabolism
Module
nwa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nwat_2773
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_2773
Enzymes [BR:nwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nwat_2773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ADJ29539
UniProt: D8KAW2
LinkDB All DBs
Position
2949667..2950101
Genome map
AA seq 144 aa AA seqDB search
MMTNHGNRITQGQFSFLPDLTDEQILAQIKYALKNDWAVNVEYTDDPHPRNTYWEMFGIP
MFDLKDPAGIMMEINDCRKTYPNHYVRVTAFNSHRGVESPCMSFIVNRPEKEPGFGLVRQ
EVDGRHINYTVRSYAADRPEGERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatcatggaaaccgtatcactcagggacagttctcgttcctgcctgattta
acggacgagcagattttagcgcagatcaaatatgcgctgaaaaatgattgggcggtcaat
gtggaatacactgatgatccccatccacgcaatacttattgggaaatgtttggcattcct
atgttcgatctgaaagatcccgccgggatcatgatggaaatcaacgattgccgtaaaacc
taccctaatcactacgtccgggtaacggcgtttaacagccatcggggcgttgagtcaccc
tgtatgtcctttatcgttaatcgccccgaaaaggagcctggcttcggactggtgcggcag
gaagtagatggccgccatatcaactatactgtacgcagctatgcggctgacaggccggaa
ggcgagcggtattaa

DBGET integrated database retrieval system