KEGG   Neisseria weaveri: SAMEA3174300_1257Help
Entry
SAMEA3174300_1257 CDS       T04355                                 

Gene name
pbp3
Definition
(GenBank) penicillin-binding protein 3
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
nwe  Neisseria weaveri
Pathway
nwe00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nwe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAMEA3174300_1257 (pbp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nwe01002]
    SAMEA3174300_1257 (pbp3)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nwe01011]
    SAMEA3174300_1257 (pbp3)
Enzymes [BR:nwe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SAMEA3174300_1257 (pbp3)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SAMEA3174300_1257 (pbp3)
Peptidases and inhibitors [BR:nwe01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   SAMEA3174300_1257 (pbp3)
Peptidoglycan biosynthesis and degradation proteins [BR:nwe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SAMEA3174300_1257 (pbp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: SAY51363
LinkDB All DBs
Position
1:complement(1359486..1360868)
Genome map
AA seq 460 aa AA seqDB search
MVLKDLRSVVSLLLGLTVLQAAAVDLGRIRAEEVAVYVQDLNSGEVLEAHREDVALNPAS
AMKLVTAFAALRSLGSDYRWQTELKTAAGQRNGVLDGDIYWVGSGDPVLDQDGLTAMQQQ
LRDGGISRINGQLVLDGSVWNGRDSADGFSDDSGEPFMTAPDPHMLAYKVVWAVPERNES
GGVAIRTNPPLPNIAFDNRVSLSGSASACGSLSSYMNAVYGKGVLSFSGSLPESCLGKEM
FINMLEPKEFAQHSFINQWRAAGGSISDGLRLGRAESGAKVVARHRSKRLAEVLSDMNKF
SNNLIARTVFLKMGERSADGLTAQHSEAAVRRELASAGLDDEALVLENGSGLSRRERITA
KMLGQMLGKAYRSPFQTAFVDSLPIAGTDGTLKTRFKHIGPPLRLKTGTLKNVRALAGYY
LDDKRPLAVVVLLNSPRAGGLLEELDALVTRIVQTYRSKP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggttttgaaagatttgagaagcgtagtttctttactgttgggtttaacggttttgcag
gcggctgcggtggatttggggcgtatccgcgccgaagaagtggcggtgtatgttcaggat
ttgaacagcggcgaagtgttggaagcgcatcgggaagacgtggcattgaatccggcttcg
gcgatgaagctggttacggctttcgccgcactgcgcagcttgggttcggattaccgttgg
caaacggagctgaaaacggcagccggacagcgcaacggtgtgttggacggcgatatttat
tgggtcggcagcggcgatcccgtgttggatcaggacggcttgacggcaatgcagcagcag
cttcgcgacggcggtattagccggattaacggccagctggtgttggacggcagcgtttgg
aacggccgcgacagtgcggacggtttttcggacgattcgggcgagccgtttatgacggcg
cctgatccgcatatgctggcctataaagtggtgtgggccgtgcccgaacggaatgaatca
ggcggtgtggcaatacgcaccaatccgcctttgcccaatattgcctttgataaccgtgtg
agtttgagcggttcggcttccgcttgcggttcgttgtcgagctacatgaatgcggtatac
ggtaaaggcgtgttgtcgttcagcggcagtctgccggaaagctgcttgggcaaggaaatg
tttatcaatatgcttgagccgaaagagtttgcgcaacacagttttatcaatcaatggcgt
gcggcgggcggcagtatttcagacggcctgagattgggtagggcggaatcgggagccaaa
gtggtggcgcggcaccgctccaaacgcttggcggaagtgttgtcggatatgaacaagttt
tccaacaatctgattgcgcgcacggtctttttgaagatgggcgagcgctctgctgacggt
ttgacggcgcaacactcggaagcggcagttcgccgtgagctggcatccgccggtttggac
gatgaggcattggtgttggaaaatggttcgggcttgtcgcgccgcgagcggattacggcg
aaaatgttgggacagatgctcggcaaagcctaccgcagtccttttcagacggcctttgtc
gacagtttgccgatcgcggggacggacgggacgctgaaaacccgtttcaaacatatcggc
ccaccgctgcgcctgaaaacaggcacgctgaaaaatgtgcgggcattggcaggttattat
ctcgacgacaaacgtcctttggcggtggtggtgttgttgaacagcccgagagcaggcggt
ttgctggaagaattggatgctttggtgacgcggattgtacagacgtaccgaagcaaacct
taa

DBGET integrated database retrieval system