KEGG   Nitrobacter winogradskyi: Nwi_0031Help
Entry
Nwi_0031          CDS       T00276                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Nwi_0031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nwi02000]
    Nwi_0031
Enzymes [BR:nwi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Nwi_0031
Transporters [BR:nwi02000]
 Other Transporters
  Pores ion channels [TC:1]
   Nwi_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ABA03299
UniProt: Q3SWP2
LinkDB All DBs
Position
35623..36219
Genome map
AA seq 198 aa AA seqDB search
MMKLYWSPRSRSFTALWLMEETGQPYERVLIDISTGAQKTPEFLAVNPMGKVPALTDGAI
AIAEAAAICAYVAERFPDAKLAPPLGDARRAKYLQWLFFGPSCIEPALLQIFAKLQVPSS
TAAWGDATQVFDVLDKAVEKGPWILGDDFSAADIVIGSGLNFAIRQFKMVPPRPAFDRYI
DRCVARPAFQRAEKIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactctactggtcgccgcgctcgcgctcgttcaccgcgctctggctgatggag
gaaaccggacaaccctatgagcgggttctgatcgacatctccaccggcgcgcagaagacg
ccggagtttctcgccgtcaacccgatggggaaggtgcccgcgctgaccgacggcgctatc
gcgatcgccgaagcggcggcgatctgcgcctacgtcgccgagcgtttcccggatgcgaag
ctggccccgccgctcggggatgcgcgccgggcaaaatatctgcaatggctgttcttcgga
ccgagttgcattgaaccggcgctgctccagatcttcgccaagctccaggtgccatcgagc
acggccgcgtggggggacgccacgcaggtgttcgacgttctcgacaaggccgtggaaaag
gggccgtggattctcggcgacgacttctccgccgccgacatcgtgatcggctccgggctg
aactttgcgatccgccagttcaagatggtgccgccgcggccagctttcgatcgctacatc
gaccgctgcgtggcgcggccggcgtttcaacgcgcggagaaaatcgcggcgggctga

DBGET integrated database retrieval system