KEGG   Nitrobacter winogradskyi: Nwi_1055Help
Entry
Nwi_1055          CDS       T00276                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00473  D-Alanine metabolism
nwi00550  Peptidoglycan biosynthesis
nwi01100  Metabolic pathways
nwi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Nwi_1055
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nwi_1055
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Nwi_1055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nwi01011]
    Nwi_1055
Enzymes [BR:nwi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Nwi_1055
Peptidoglycan biosynthesis and degradation proteins [BR:nwi01011]
 Precursor biosynthesis
  Amino acid ligase
   Nwi_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABA04317
UniProt: Q3STS4
LinkDB All DBs
Position
1150386..1151378
Genome map
AA seq 330 aa AA seqDB search
MRITILFGGSNKERLVSVASAQALHHALPEADLWFWNLRDEIVDVRSETLRDHARPFEDE
FVPGGSGAPLERALDRARAEDRVLVLGLHGGRAENGELQAMCELRRIPFTGSGSAASHLA
FDKVAAKRFVASAGVPTPAHVLLEDIDHALAEHGRLVAKPACDGSSYGLIFVNAPQDIVT
VREAAKTEDYVIEPFVSGVEATCGVLEHSDGSVVALPPVEIVPAEGAFDYAAKYLAKTTQ
EICPGRFSPEIAAQIMDHSLRAHRALSCRGYSRTDFIVTGNGPIYLETNTLPGLTAASLY
PKALHAQGVGFADFLRDQIVLAEKAVRPNL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcaccattctgttcggcggcagcaacaaggagcgtctggtttcagtcgcgagc
gcgcaggcgctccatcacgcattgccggaggccgatctgtggttctggaaccttcgcgat
gaaatcgtcgacgtgcgatccgaaacgctgcgggatcatgcgcggccgttcgaggacgag
ttcgttcccggcggatcaggcgcgccgctggagcgggcgctggacagggccagggcggag
gatcgcgtgctggtgctcggcctccacggaggccgcgccgagaacggtgaacttcaggcg
atgtgcgagcttcgccgaattcctttcacgggatcgggttcggccgcctcgcatcttgcg
ttcgacaaggtggcggccaagcggttcgtggcctcggccggggtccccacgccggcgcac
gtcttgctggaggacattgaccacgcgctggccgaacacggccggctggttgccaagccc
gcatgcgacggatcgagctatggcctgatcttcgtcaacgcgccgcaggatatcgtcacc
gtccgcgaggcggcgaagaccgaggactatgtgatcgaacctttcgtgtctggcgtcgag
gcgacctgcggcgtgctggagcattccgacggctcggtcgtcgcgcttccgccggtcgag
atcgtgccggccgagggcgcgttcgattacgccgcgaagtatctggcgaagacgacgcag
gagatctgtccgggacgtttttcgccggagatcgccgcgcagatcatggatcactcgctg
cgggcgcatcgcgcgttgtcctgccgcggctattcccgcaccgactttatcgtgacaggc
aatggaccgatctatctggaaaccaacaccctgccgggcctgaccgcggcctcgctttac
cccaaggcgcttcatgcgcagggggtcgggttcgctgattttctgcgcgaccagatcgtg
ctcgccgaaaaggccgtccgtccgaacctctag

DBGET integrated database retrieval system