KEGG   Nitrobacter winogradskyi: Nwi_1849Help
Entry
Nwi_1849          CDS       T00276                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00061  Fatty acid biosynthesis
nwi00780  Biotin metabolism
nwi01100  Metabolic pathways
nwi01212  Fatty acid metabolism
Module
nwi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Nwi_1849
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Nwi_1849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nwi01004]
    Nwi_1849
Enzymes [BR:nwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Nwi_1849
Lipid biosynthesis proteins [BR:nwi01004]
 Fatty acid synthase
  Component type
   Nwi_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: ABA05109
UniProt: Q3SRI2
LinkDB All DBs
Position
complement(2026895..2027350)
Genome map
AA seq 151 aa AA seqDB search
MESPVRFEHVDIATILKTLPHRYPFLLIDRVLNIRADHSGIGVKNVTFNEPAFQGHFPER
PVYPGVLMIEGMAQTAGVIGIMSVEGTEKPRAVYFLTIDKCKFRKPVMPGDIVEYHMRSI
GRRKTMWWFHGDAKVNGTIVAEADVGAMLTD
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgccggtcaggttcgagcacgtggacattgccaccattctcaaaacccttcct
catcgttatccgtttctgctgatcgatcgcgtcctcaatattcgggccgaccatagcggg
atcggcgtcaagaacgtcacgttcaatgagcccgcgtttcaggggcactttccggagcgg
ccggtttatccgggagtgcttatgatcgaggggatggcgcagacggcgggcgttatcggc
atcatgtcggtggaaggcacggagaagccgcgcgcggtctattttctgacgatcgacaag
tgcaagttccgcaagcccgtcatgcccggcgatattgtcgagtatcacatgcgcagcatc
gggcgtcgcaagacgatgtggtggttccacggcgatgccaaggtgaacggcacgatcgtc
gccgaagccgacgtcggcgcgatgctgaccgactga

DBGET integrated database retrieval system