KEGG   Nitrobacter winogradskyi: Nwi_2928Help
Entry
Nwi_2928          CDS       T00276                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00630  Glyoxylate and dicarboxylate metabolism
nwi00710  Carbon fixation in photosynthetic organisms
nwi01100  Metabolic pathways
nwi01120  Microbial metabolism in diverse environments
nwi01200  Carbon metabolism
Module
nwi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nwi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nwi_2928
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwi_2928
Enzymes [BR:nwi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nwi_2928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABA06178
UniProt: Q3SNG3
LinkDB All DBs
Position
complement(3163947..3164372)
Genome map
AA seq 141 aa AA seqDB search
MRITQGCFSFLPDLTDDQISRQIQYCLSQNWAVNIEFTDDPHPRNTYWEMWNLPMFDLPD
AAGVLMELKECRKVYGDRYIRISGFDSSPGWESVKISFIVNRPKNEPGFRLERQESDSRN
VRYTTTSYAVAERSEGQRYSS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattactcaaggttgtttttcgttcctgcccgatctgaccgatgatcagatttcc
cggcagatccagtattgtctcagccagaactgggcggtgaacattgagttcaccgacgat
ccgcatccccgcaatacctattgggaaatgtggaatctgccgatgttcgacctgccggat
gcggcaggcgtgctgatggagctgaaggagtgccggaaggtctatggcgaccgctacatc
cggatctccgggttcgattccagtcctggctgggagtcggtgaagatctcgttcatcgtc
aacaggccgaagaacgagccgggcttccggctcgagcgccaggaatccgatagtcgcaac
gtccggtacaccacgacctcttatgcggtggccgaacgttccgaaggtcagcgctattca
tcatga

DBGET integrated database retrieval system