KEGG   Nitrobacter winogradskyi: Nwi_2990Help
Entry
Nwi_2990          CDS       T00276                                 

Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00564  Glycerophospholipid metabolism
nwi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nwi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Nwi_2990
Enzymes [BR:nwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Nwi_2990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 Pyr_redox_2 Pyr_redox FAD_binding_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABA06240
UniProt: Q3SNA1
LinkDB All DBs
Position
complement(3233767..3235341)
Genome map
AA seq 524 aa AA seqDB search
MTLSYKMMEEGAPVGQVYDLAIIGGGINGCGIARDAAGRGNSVFLCEMNDLASGTSSGST
KLVHGGLRYLEYYEFRLVREALIEREILWRIAPHIIHPARFVLPHHAGLRPAWLLRFGLF
LYDHIGGRKLLPPTRSVDLARDRVGKPLSPGRYHKGFEYSDCVVDDARLVILTARDAADR
GADIRTRTRAVETRPSDGFWRVTVEDTRSGERSTIAARVLVNAGGPWIEQVLRLGAGVNS
RARVRLVQGSHIVVGKLYDHDRAYIFQNSDGRIVFAIPYQDDFTLIGTTDRDYEGDPARV
KASDEEIAYLCASVSEYLAKQVAPRDVVWSYAGVRPLYDDGASEAKAATREYAFELDTPE
GAPLLSVYGGKITTYRRLAEEALEKLSPYLKGTKAREGWTSKAALPGGDMEVSAVEGIPA
DLMRGYPFLTLAHARRLARAYGSRAAAMLGTAKTMADLGREFGATLTEREVRYLMTNEWA
CTAEDVIWRRSKLGLRMSVADVAALETWFAEQTEGRLREAEARP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacgctttcatataagatgatggaggagggtgcgcccgtgggtcaggtttacgacctc
gctatcatcggcggcggcatcaacggctgcgggatcgcgcgcgacgcggccgggcgtggc
aactcggtcttcctgtgtgaaatgaacgacctcgcgagtggcacctcgtcaggatcgacc
aagctggtgcatggcggactgcgttatctggaatattacgagttccgcctggttcgcgaa
gccctgatcgagcgcgagatcctctggcggatcgcgcctcacatcattcatccggcgcgc
ttcgtgctgccgcatcacgccggcctgaggccggcatggctgctgcggttcggcctcttc
ctttacgatcatatcggaggccgaaagctgttgccaccgacgcgctcggttgaccttgcg
cgcgatcgggtcggaaagccgctgagtccgggccgctaccataagggtttcgaatattcc
gactgcgtggtcgacgatgcccgtctcgtcattctgacagcgcgcgatgcggccgatcgc
ggagccgatatccggacccggacgcgcgcggtcgagacccgtccgtccgacggcttctgg
cgcgtcacggtcgaggatacacgaagcggcgaacgcagcacgatcgccgcgcgagtgctg
gtcaacgcgggcgggccctggatcgaacaggtgctgcggctgggcgccggcgtcaacagc
cgcgcgcgggtgcggctggtgcaggggtcgcatatcgtggtcggcaagctctacgatcac
gaccgcgcctacatcttccagaacagcgacggccggatcgtgttcgccattccctatcag
gatgacttcaccctgatcgggaccacggatcgcgactatgagggggaccccgccagggtg
aaggcgtcggatgaggaaatcgcctatctctgcgcctcggtcagcgagtatctggcgaaa
caggtcgcgccgcgggatgtcgtttggtcctatgccggggtgcggcctctctatgatgac
ggcgcgagcgaggccaaggccgctacccgtgaatacgcttttgaactcgatacgcctgaa
ggcgcgccgctgctgtcggtctatggcggcaagatcacgacctatcgccggcttgccgaa
gaggcgctggaaaagctgtcaccctatctgaaggggacaaaggcgcgcgagggctggacg
tcgaaggcggcgctgcccggcggagacatggaggtctccgcggttgaggggatcccggcc
gatctaatgcgaggctatccttttctgacgctggcgcacgcgcgccgtcttgcgcgcgca
tatggctcccgcgccgccgcgatgctggggacggcgaaaacgatggcggatctgggccgc
gaattcggggccacgctcacggaacgcgaggtccgctatctcatgaccaacgaatgggct
tgcaccgcggaggatgttatctggcgacgctccaagcttggcttgcggatgtcggtggca
gacgtcgccgcgcttgagacctggttcgcggagcagacggagggacgcttgagggaggcg
gaagcgcgcccatga

DBGET integrated database retrieval system