KEGG   Nitrosococcus wardiae: E3U44_00220Help
Entry
E3U44_00220       CDS       T05933                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
nwr  Nitrosococcus wardiae
Pathway
nwr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nwr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    E3U44_00220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nwr01001]
    E3U44_00220
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nwr02044]
    E3U44_00220
Enzymes [BR:nwr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     E3U44_00220
Protein kinases [BR:nwr01001]
 Serine/threonine kinases: Other
  Bacterial family
   E3U44_00220
Secretion system [BR:nwr02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   E3U44_00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo DUF1679
Motif
Other DBs
NCBI-ProteinID: QBQ53101
UniProt: A0A4P7BTB1
LinkDB All DBs
Position
complement(47109..48137)
Genome map
AA seq 342 aa AA seqDB search
MSISEEQAKEVSSLKIPGYKIQRMIGQGGMAKVYLAIQESLDRKIALKIMTPPLDIDHSL
CERFLKEGKIVAQLSHPSIVTVYDVGCFGNYYYMAMEYLGGANLKQRIQQQAPLACPLKI
IRQVASALGYAHAHGFVHRDVKPANILFKEDGTAVLTDFGIAKPLTAHTQLTAVGFCVGT
PEYMSPEQATGKKLDGRSDLYSLGVVFYEMLTGQKPFIGEDAIATILMHAQSPIPSLPSQ
FATYQPLVERLLAKDPNDRFEDAGALITFVDHFSGLAEREVVQKTGTSRLFPTQVMAGET
RVFIEPSPEKKSLIHRTRRWTMGIGLLAVVFVGTYLFFSPRL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttctgaggagcaggcaaaagaagtctcttccctgaagattcctggctataag
atccagaggatgatcggtcagggggggatggcgaaggtttatcttgccatccaggagtcc
ctcgatcgaaagattgctctcaagatcatgacgcctcctcttgatatcgaccattcattg
tgcgagcggttcttaaaggaggggaagattgtcgcccaattaagccatccgagcattgtc
actgtgtatgacgttggttgttttggtaactattactatatggctatggagtatcttggc
ggggctaatcttaagcagcgcatccagcagcaagcccccctggcctgccctttaaaaatt
atccgacaagttgccagtgcccttggctatgcccatgctcacggttttgtccatcgggat
gtcaagccggcgaatattctctttaaggaggatggcactgccgttctgactgacttcggt
atcgctaaaccgctgactgctcatactcagttgactgcagtgggcttctgtgttggaaca
cccgaatacatgagtccggagcaagcgacgggcaaaaagctagatggacgttctgatctc
tacagcttgggggtcgtattctatgaaatgttgacaggccaaaaaccctttatcggagag
gacgcgattgctaccattttgatgcatgcgcaaagccctattcctagtttaccttctcag
tttgccacttatcagccccttgtggagcgcttgttagctaaagatcctaatgaccgattt
gaggatgcgggggcattaatcactttcgttgatcatttctctggccttgccgagagggag
gtagttcaaaaaacggggacttcgcgtttgtttcctacccaagtaatggcgggagagacc
cgagtattcattgagcccagcccggagaagaaatcattaatccacaggaccaggcgctgg
accatggggattggattgctggctgtagtctttgtggggacttacctctttttttcccct
cgcttatag

DBGET integrated database retrieval system