KEGG   Ornithorhynchus anatinus (platypus): 100073613
Entry
100073613         CDS       T01045                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01523  Antifolate resistance
oaa04010  MAPK signaling pathway
oaa04014  Ras signaling pathway
oaa04062  Chemokine signaling pathway
oaa04064  NF-kappa B signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04210  Apoptosis
oaa04380  Osteoclast differentiation
oaa04620  Toll-like receptor signaling pathway
oaa04621  NOD-like receptor signaling pathway
oaa04622  RIG-I-like receptor signaling pathway
oaa04623  Cytosolic DNA-sensing pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04657  IL-17 signaling pathway
oaa04658  Th1 and Th2 cell differentiation
oaa04659  Th17 cell differentiation
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04668  TNF signaling pathway
oaa04920  Adipocytokine signaling pathway
oaa05132  Salmonella infection
oaa05135  Yersinia infection
oaa05142  Chagas disease
oaa05145  Toxoplasmosis
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05162  Measles
oaa05163  Human cytomegalovirus infection
oaa05164  Influenza A
oaa05165  Human papillomavirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05168  Herpes simplex virus 1 infection
oaa05169  Epstein-Barr virus infection
oaa05170  Human immunodeficiency virus 1 infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05212  Pancreatic cancer
oaa05215  Prostate cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05222  Small cell lung cancer
oaa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oaa05340  Primary immunodeficiency
oaa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100073613 (IKBKG)
   04014 Ras signaling pathway
    100073613 (IKBKG)
   04064 NF-kappa B signaling pathway
    100073613 (IKBKG)
   04668 TNF signaling pathway
    100073613 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100073613 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100073613 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100073613 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100073613 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100073613 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100073613 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100073613 (IKBKG)
   04660 T cell receptor signaling pathway
    100073613 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100073613 (IKBKG)
   04659 Th17 cell differentiation
    100073613 (IKBKG)
   04657 IL-17 signaling pathway
    100073613 (IKBKG)
   04662 B cell receptor signaling pathway
    100073613 (IKBKG)
   04062 Chemokine signaling pathway
    100073613 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100073613 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100073613 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100073613 (IKBKG)
   05203 Viral carcinogenesis
    100073613 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100073613 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100073613 (IKBKG)
   05221 Acute myeloid leukemia
    100073613 (IKBKG)
   05220 Chronic myeloid leukemia
    100073613 (IKBKG)
   05215 Prostate cancer
    100073613 (IKBKG)
   05222 Small cell lung cancer
    100073613 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100073613 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100073613 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100073613 (IKBKG)
   05135 Yersinia infection
    100073613 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100073613 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100073613 (IKBKG)
   05162 Measles
    100073613 (IKBKG)
   05164 Influenza A
    100073613 (IKBKG)
   05161 Hepatitis B
    100073613 (IKBKG)
   05160 Hepatitis C
    100073613 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100073613 (IKBKG)
   05163 Human cytomegalovirus infection
    100073613 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100073613 (IKBKG)
   05169 Epstein-Barr virus infection
    100073613 (IKBKG)
   05165 Human papillomavirus infection
    100073613 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100073613 (IKBKG)
   05142 Chagas disease
    100073613 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100073613 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oaa01001]
    100073613 (IKBKG)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100073613 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 zf_C2H2_ZHX Cnn_1N
Other DBs
NCBI-GeneID: 100073613
NCBI-ProteinID: XP_007668968
LinkDB
Position
6
AA seq 598 aa
MNGNQRNHACEMVQPNGGPASEFETLREDSSLGKSAMLHLPADQDPQEALQRFLVENQEL
REAIRQSNQMLREWYKEFLNFQANHKEEKEFLRRKFQGARNLVERLNLEKIDLKRQRERA
LQELEQLKRSQKLAALGTEAPVFEDTETVTLTNELVDLAMVPGEKTDYLQALKEQKEQLE
NHLQQLQKTNHSLLMEKLALLTENQELKLKVPPRQPEEPRLKVKENGILPERLLETESLQ
GASGSARTGNSDELLKKRLRDTEDENTSLKQELASLQGEMTQLLTREKEGERKAEQQLQA
LKKQVEQLTEDKASVKAQVTSLLGELQESQSRLEVANKEKQSLEDRARIASEKAKKQESE
NETLHKQHSVQVDQLRLQAQNLDSALRMERQIASEEKRKLAQLQAAYHQLFQEYDNHIKS
SLASNERNREIDLQLDALNQQLQQAEEALVAKQELIDKLKEEAEQHRTIMETIPVLKAQA
DIFKADFQAERQAREKLAERKEFLQDQLEQMQRELNKLKADSQEATRERIEDMRRRHLEN
SQPPLPQPAHLVNHLPFHSLSTQRRSLPDEQPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgaacgggaatcagaggaatcacgcttgtgaaatggtgcagccaaacggggggccggcg
agtgagttcgagaccctcagggaagattcttccctgggaaagtcagccatgctgcacctg
cctgcagaccaagaccctcaagaggccctacaacggttcctggtagagaaccaggagctg
agagaggccatccggcagagcaaccagatgctccgggagtggtacaaagagttcttaaac
ttccaagccaaccataaagaggagaaggaatttctaaggagaaaatttcaaggggcccgg
aacctggtggagcggctgaacttggaaaagatcgacttgaagagacagagggagcgagct
ctgcaagaattggagcagctgaagcgaagtcagaagcttgctgccctagggacggaagca
ccggtttttgaagacacagaaacggtcacactcaccaatgagctggttgatcttgccatg
gtgcctggtgagaagacagactatctccaggctctgaaggagcaaaaagaacaactagag
aaccatttgcagcagttgcaaaaaactaatcacagccttctcatggagaaactggccctc
ttgaccgagaaccaggagctgaagttgaaagtgcccccgaggcagcctgaagagccacgt
ctcaaagtcaaggaaaatggaattttgccagagaggcttttggagacagagtccttgcag
ggggcaagtggcagtgccaggactgggaattcagatgaattgctgaagaagaggctgaga
gacacggaagatgagaacacatctctgaagcaggagctggcgtctctgcagggggaaatg
acccagctattgaccagggagaaggagggtgagaggaaagccgaacagcagttgcaggcg
ttgaagaagcaagttgagcaactgacggaggataaagcctccgtgaaagcccaggtgaca
tcgctgcttggggaactgcaagagagccagagtcgcctggaagtagcaaataaagagaag
cagagcctcgaggacagagcccgaattgcaagtgagaaagccaaaaagcaagagagtgag
aacgagacccttcacaagcagcacagcgtgcaggtggaccaattgcgactgcaagcccaa
aacctggattctgccctgcgcatggaacgccagattgcctctgaagagaagcggaagctg
gcacagttacaagccgcctatcaccagctctttcaggaatacgacaaccacatcaagagc
agtctggcaagcaacgagagaaatcgggaaatcgacctccagctggatgccctgaatcag
cagctgcagcaggccgaagaggctctggtggcgaaacaggaactgatcgacaaactcaag
gaggaagcggagcagcacaggactatcatggaaaccatccccgtcctgaaggcgcaggct
gatatcttcaaggctgacttccaggccgaaaggcaagcccgggaaaagttggccgagcgg
aaagagttccttcaggaccagctggaacagatgcagagggagcttaacaaattgaaggct
gattcccaagaagcaacccgggagaggatagaggacatgaggaggcgacacttagagaac
tctcagccacctttaccccagccagctcatctcgtgaaccatctccccttccactcgttg
tccacccagagaagaagccttccagatgagcaacctgatttctgttgcccaaaatgccag
tatcaggccccggatatggacaccttgcagatccacgtcatggaatgtatcgagtaa

DBGET integrated database retrieval system