KEGG   Ornithorhynchus anatinus (platypus): 100074365Help
Entry
100074365         CDS       T01045                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00562  Inositol phosphate metabolism
oaa01100  Metabolic pathways
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa04068  FoxO signaling pathway
oaa04070  Phosphatidylinositol signaling system
oaa04071  Sphingolipid signaling pathway
oaa04115  p53 signaling pathway
oaa04140  Autophagy - animal
oaa04150  mTOR signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04218  Cellular senescence
oaa04510  Focal adhesion
oaa04931  Insulin resistance
oaa05165  Human papillomavirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05200  Pathways in cancer
oaa05206  MicroRNAs in cancer
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05218  Melanoma
oaa05222  Small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05230  Central carbon metabolism in cancer
oaa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100074365 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100074365 (PTEN)
   04070 Phosphatidylinositol signaling system
    100074365 (PTEN)
   04071 Sphingolipid signaling pathway
    100074365 (PTEN)
   04151 PI3K-Akt signaling pathway
    100074365 (PTEN)
   04150 mTOR signaling pathway
    100074365 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100074365 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100074365 (PTEN)
   04218 Cellular senescence
    100074365 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100074365 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100074365 (PTEN)
   05206 MicroRNAs in cancer
    100074365 (PTEN)
   05230 Central carbon metabolism in cancer
    100074365 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100074365 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100074365 (PTEN)
   05214 Glioma
    100074365 (PTEN)
   05218 Melanoma
    100074365 (PTEN)
   05215 Prostate cancer
    100074365 (PTEN)
   05213 Endometrial cancer
    100074365 (PTEN)
   05224 Breast cancer
    100074365 (PTEN)
   05222 Small cell lung cancer
    100074365 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100074365 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100074365 (PTEN)
   05165 Human papillomavirus infection
    100074365 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100074365 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oaa01009]
    100074365 (PTEN)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100074365 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     100074365 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100074365 (PTEN)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100074365 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 100074365
NCBI-ProteinID: XP_028915617
LinkDB All DBs
Position
3
AA seq 404 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIYTSPSGPTRREDKYMF
FEFPQPLPVCGDIKVEFFHKQNKMLKKEKMFHFWVNTFFIPGPEENSDKVENGSLCGDQE
IDSISSTERPDNDKEYLILTLTKNDLDKANKDKANRYFSPNFKVKLFFTKTVEEPSNPEA
SSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgtcagcagaaacaaaaggagataccaagaggatgga
ttcgacttagacttgacctatatttatccaaacataattgctatggggtttcctgcagaa
agacttgaaggtgtatacagaaacaacattgatgatgtagtaaggtttttggattcgaag
cataaaaaccattataagatatacaatctatgtgcagaaagacattatgacaccgccaaa
tttaactgcagagttgcacagtatccttttgaagaccataacccaccacagctagagctt
atcaagcctttttgtgaagatcttgaccaatggctcagtgaagatgacaatcatgttgca
gcgatccactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttatta
catcgaggaaaatttttaaaggcacaagaagccctagatttctatggtgaagtaaggacc
agagacaaaaagggagtaactattcccagtcagagacgttatgtgtattattatagctac
ttgttaaagaatcatctggattatcgaccagtggcactgctttttcacaagatgatgttt
gaaactattccaatgttcagtggtggaacatgcaatcctcagtttgtggtctaccaatta
aaggtgaagatatacacctccccatcaggacccacaagacgtgaagataagtacatgttc
tttgagtttcctcagccgttgccagtgtgtggtgacatcaaagtggagttcttccacaaa
cagaacaagatgcttaaaaaggaaaaaatgtttcacttttgggtaaatacattcttcata
ccaggaccggaagaaaattcagacaaagtagaaaatggaagtctatgtggcgatcaagaa
attgatagcatttctagtacagagcgcccagataacgacaaggaatatctaatccttaca
ttaacaaaaaacgatttagacaaggcaaataaagacaaggccaacagatacttctctcca
aactttaaggtgaagctgttcttcacaaaaacggtagaagagccatcaaatccggaggct
agcagctcaacttcagtaacaccagacgttagtgacaacgaacctgatcattatagatat
tctgacaccactgactctgatccagagaacgaaccttttgatgaagatcagcatacgcag
attacgaaagtctga

DBGET integrated database retrieval system