KEGG   Ornithorhynchus anatinus (platypus): 100074446Help
Entry
100074446         CDS       T01045                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00500  Starch and sucrose metabolism
oaa01100  Metabolic pathways
oaa04151  PI3K-Akt signaling pathway
oaa04152  AMPK signaling pathway
oaa04910  Insulin signaling pathway
oaa04922  Glucagon signaling pathway
oaa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100074446 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100074446 (GYS1)
   04152 AMPK signaling pathway
    100074446 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100074446 (GYS1)
   04922 Glucagon signaling pathway
    100074446 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    100074446 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oaa01003]
    100074446 (GYS1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100074446 (GYS1)
Glycosyltransferases [BR:oaa01003]
 Polysaccharide
  Storage polysaccharide
   100074446 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 100074446
NCBI-ProteinID: XP_001505412
LinkDB All DBs
Position
Un
AA seq 740 aa AA seqDB search
MPLSRSLSGSSLPGLEDWQDDIDLDNAVLFEVAWEVANKVGGIYTVIQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPLPALKRTLDSMNSKGCKVYYGRWLIEGGPPVILLDVG
AAAWALERWKGELWESCSIGVPWYDREANDALLFGFLTAWFLGEFYAQCEEKPFLIGHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDLVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFSLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSNQ
TVVAFFIMPARTNNFNVESLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGNLPDMNKML
DKEDFTMMKRALFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCTQLTSFLYSFCQQSRRQRIVQRNRTERLSDLLDWKY
LGRYYMFARHMALAKAFPDYFTYEPHDADAVSGADGSGRGLCYPRTASVPPSPSLSRHSS
PHQSEGEEEDCDEAERYDEDEEAEKDRRNIRALEWQRRPSPGLLAQSGAKRGSVDTAPSS
SASSLSEPVSPTSSLGEERN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgagccgcagcctgtctggtagctccctgccggggctggaggactggcaggat
gacatcgacctggacaacgcggtgctcttcgaggtggcctgggaggtggccaataaagtg
ggcgggatctacacggtgatccagacgaaggcgaaagtgaccggggacgagtggggggac
aattactacctggtgggcccctacacggagcagggggtccgcacccaggtggagctgctg
gagcccccgctgcccgcactgaagcgcaccctggactccatgaacagcaaaggctgcaag
gtgtactacgggcgctggctgattgaggggggcccgccggtcatcctgttggacgtgggg
gcggcagcctgggcgctggagcgctggaagggggagctgtgggagagctgcagcatcggc
gtcccctggtacgaccgcgaggccaacgatgccctcctctttggctttctcaccgcctgg
ttcctgggcgagttctacgcgcagtgcgaggagaagccgttcctgatcggccacttccac
gagtggctggccggcgtgggcctctgtttgtgccgggcccgccgcctgcccgtggccacc
atcttcaccacccacgccaccctcctcgggcgctatctctgcgccggggccgtcgacttc
tacaacaacctggagaacttcaacgtggacaaggaggccggcgagcggcagatctaccac
cggtactgcatggagcgtgcggccgctcactgcgcccacgtcttcaccaccgtctcccag
atcaccgccatcgaggcccagcacctgctcaagaggaagcccgacttagtaacccccaac
gggctcaacgtgaagaagttctcggccatgcacgagttccagaacctgcacgcccagagc
aaggcccggatccaagagtttgtgcgcggacacttctatgggcaccttgacttcagcttg
gataagaccctgttcttcttcattgctggacgctacgagttttccaacaagggagcggat
gtgttcctcgaggccctggcccgcctcaactacctgctccgggtgaacggcagcaaccag
acggtggtagcgttcttcatcatgcccgccaggaccaacaacttcaacgtggagtccttg
aagggtcaggccgtgcggaagcagctctgggacacggccaacacggtgaaggagaagttc
ggaaggaaactgtacgagtctctgctggtgggcaacctcccagacatgaacaagatgctg
gacaaggaggatttcaccatgatgaagcgagccctctttgccactcagcgccagtctttc
ccccccgtctgcacccacaacatgctggacgactcttcagaccccatcctcaccaccatc
cgccgcatcggcctcttcaacagcagcgcggatcgtgtcaaggttatcttccaccccgag
ttcctgtcctccaccagcccccttctgccagtggactacgaagagtttgtccgtggctgt
cacctgggtgtcttcccttcttactacgagccctgggggtacacgcccgccgagtgcacg
gtcatgggcatccccagcgtgtccaccaacctgtccggctttggctgcttcatggaagag
cacatagctgatccctcagcctacggcatctacatcctggaccggcggttccgcagcctg
gacgactcgtgcacccagctgacgtccttcctgtacagcttctgccagcagagccggcgc
cagcgtatcgtccagcgtaaccgcaccgagcggctctccgacctgctggactggaagtac
ctgggccggtattatatgtttgcccggcacatggctctggccaaagcttttccagattac
ttcacttacgagccccacgacgccgacgcggtgagcggggccgatggcagtgggcgggga
ttatgctacccccgcacggcctcggtgcccccctcgccttccctgtcccgccactcgagc
ccccaccagagcgagggggaggaggaggactgcgacgaagcagagcgctacgacgaggat
gaggaggcggagaaggaccgacgcaacatccgggccctcgagtggcagcgccgcccctcg
cccggcctcctcgcccagagcggggccaagcgcggctccgtggacaccgccccctccagc
tcggccagctccctcagtgagcccgtcagccccaccagctccctgggggaggagcgcaac
taa

DBGET integrated database retrieval system