KEGG   Ornithorhynchus anatinus (platypus): 100074633
Entry
100074633         CDS       T01045                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01523  Antifolate resistance
oaa04010  MAPK signaling pathway
oaa04014  Ras signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04064  NF-kappa B signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04137  Mitophagy - animal
oaa04151  PI3K-Akt signaling pathway
oaa04210  Apoptosis
oaa04211  Longevity regulating pathway
oaa04218  Cellular senescence
oaa04380  Osteoclast differentiation
oaa04620  Toll-like receptor signaling pathway
oaa04621  NOD-like receptor signaling pathway
oaa04622  RIG-I-like receptor signaling pathway
oaa04623  Cytosolic DNA-sensing pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04657  IL-17 signaling pathway
oaa04658  Th1 and Th2 cell differentiation
oaa04659  Th17 cell differentiation
oaa04660  T cell receptor signaling pathway
oaa04662  B cell receptor signaling pathway
oaa04668  TNF signaling pathway
oaa04722  Neurotrophin signaling pathway
oaa04917  Prolactin signaling pathway
oaa04920  Adipocytokine signaling pathway
oaa04926  Relaxin signaling pathway
oaa04931  Insulin resistance
oaa04932  Non-alcoholic fatty liver disease
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa05010  Alzheimer disease
oaa05022  Pathways of neurodegeneration - multiple diseases
oaa05030  Cocaine addiction
oaa05132  Salmonella infection
oaa05133  Pertussis
oaa05134  Legionellosis
oaa05135  Yersinia infection
oaa05140  Leishmaniasis
oaa05142  Chagas disease
oaa05145  Toxoplasmosis
oaa05146  Amoebiasis
oaa05152  Tuberculosis
oaa05160  Hepatitis C
oaa05161  Hepatitis B
oaa05162  Measles
oaa05163  Human cytomegalovirus infection
oaa05164  Influenza A
oaa05165  Human papillomavirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05168  Herpes simplex virus 1 infection
oaa05169  Epstein-Barr virus infection
oaa05170  Human immunodeficiency virus 1 infection
oaa05200  Pathways in cancer
oaa05202  Transcriptional misregulation in cancer
oaa05203  Viral carcinogenesis
oaa05212  Pancreatic cancer
oaa05215  Prostate cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05222  Small cell lung cancer
oaa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oaa05321  Inflammatory bowel disease
oaa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100074633 (RELA)
   04014 Ras signaling pathway
    100074633 (RELA)
   04064 NF-kappa B signaling pathway
    100074633 (RELA)
   04668 TNF signaling pathway
    100074633 (RELA)
   04066 HIF-1 signaling pathway
    100074633 (RELA)
   04071 Sphingolipid signaling pathway
    100074633 (RELA)
   04024 cAMP signaling pathway
    100074633 (RELA)
   04151 PI3K-Akt signaling pathway
    100074633 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100074633 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100074633 (RELA)
   04218 Cellular senescence
    100074633 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100074633 (RELA)
   04621 NOD-like receptor signaling pathway
    100074633 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100074633 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100074633 (RELA)
   04625 C-type lectin receptor signaling pathway
    100074633 (RELA)
   04660 T cell receptor signaling pathway
    100074633 (RELA)
   04658 Th1 and Th2 cell differentiation
    100074633 (RELA)
   04659 Th17 cell differentiation
    100074633 (RELA)
   04657 IL-17 signaling pathway
    100074633 (RELA)
   04662 B cell receptor signaling pathway
    100074633 (RELA)
   04062 Chemokine signaling pathway
    100074633 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100074633 (RELA)
   04917 Prolactin signaling pathway
    100074633 (RELA)
   04926 Relaxin signaling pathway
    100074633 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100074633 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100074633 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100074633 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100074633 (RELA)
   05202 Transcriptional misregulation in cancer
    100074633 (RELA)
   05203 Viral carcinogenesis
    100074633 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100074633 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100074633 (RELA)
   05221 Acute myeloid leukemia
    100074633 (RELA)
   05220 Chronic myeloid leukemia
    100074633 (RELA)
   05215 Prostate cancer
    100074633 (RELA)
   05222 Small cell lung cancer
    100074633 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100074633 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100074633 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100074633 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100074633 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100074633 (RELA)
   04931 Insulin resistance
    100074633 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100074633 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100074633 (RELA)
   05135 Yersinia infection
    100074633 (RELA)
   05133 Pertussis
    100074633 (RELA)
   05134 Legionellosis
    100074633 (RELA)
   05152 Tuberculosis
    100074633 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100074633 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100074633 (RELA)
   05162 Measles
    100074633 (RELA)
   05164 Influenza A
    100074633 (RELA)
   05161 Hepatitis B
    100074633 (RELA)
   05160 Hepatitis C
    100074633 (RELA)
   05168 Herpes simplex virus 1 infection
    100074633 (RELA)
   05163 Human cytomegalovirus infection
    100074633 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100074633 (RELA)
   05169 Epstein-Barr virus infection
    100074633 (RELA)
   05165 Human papillomavirus infection
    100074633 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100074633 (RELA)
   05145 Toxoplasmosis
    100074633 (RELA)
   05140 Leishmaniasis
    100074633 (RELA)
   05142 Chagas disease
    100074633 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100074633 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oaa03000]
    100074633 (RELA)
Transcription factors [BR:oaa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100074633 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100074633
NCBI-ProteinID: XP_028917326
LinkDB
Position
3
AA seq 539 aa
MDDMFPLIFASPEPTPAPGPAVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHP
TIKINGYVGPGKVRISLVTKEPPHRPHPHELVGKDCRDGFYEADLCPDRSIHSFQNLGIQ
CVKKRDLEQAITQRMQTNNNPFNVPLEEQRGDYDLNAVRLCFQVTVQDSAGRPLALPPVL
SQPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFSGQGWEARGSF
SQADVHRQVAIVFRTPPYAEPALQAPVRVLMQLRRPSDRELSEPMEFQYLPDPDDRHRIE
EKRKRTYDAFKSIVKKSPFSAGTADSRSPRRIAVPTRGVPLSHKTGGLPGLPPPAVQPYT
YSATTPSLSTINMEEFSPLSFPHVSAPAPAPAPPPQHPPPAPAPPQPGEGVLAEALLSLQ
FDSDGDGGLGGLLDDPDTVYTSLGAIDNSEFQQLLNQGPAGAAGTAAAAQGPAGEPMLME
YPESITRLMGAPQRPPDGAVPAVPAVPAAALPNGYLVPEEAFPSLVDMDITAFLNQINS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggacgacatgttccccctgatcttcgcctctccggagccgacccccgccccgggcccg
gcggtggagatcatcgagcagcccaagcagcgggggatgcgcttccgctacaagtgcgaa
ggccgctcggcgggcagcatccccggagagaggagcaccgacaccaccaagacccacccc
accatcaaaatcaacggctacgtggggccggggaaagttcgcatatccctggtgaccaag
gagcccccacaccggcctcacccccacgagctggtggggaaggactgtcgggacggcttc
tacgaggccgacctctgccccgaccgcagcatccacagcttccagaacctgggcatccag
tgcgtgaagaagcgcgacctggaacaggccatcacccagcggatgcagaccaacaacaac
ccctttaatgtgccattggaggagcagcgaggagactacgacctgaacgccgtgcggctg
tgcttccaggtgactgtgcaggactcggccggccggcccctggccctgcctccggtcctc
tcccagcccatctatgacaaccgggcccccaacacagcggagctgaagatctgccgtgtg
aaccggaactcggggagctgcctcgggggcgacgagatcttcctgctgtgcgataaagtg
cagaaagaggacatcgaggtgtgtttctcggggcagggctgggaggcccgaggctccttc
tcgcaggccgatgtgcaccggcaagtggctatcgtgttccggacgcctccctacgccgag
ccggccctgcaggccccggtccgggtcctcatgcagctgcggcggccctcggaccgtgag
ctcagcgagcccatggagttccagtacctgccggacccagatgaccgccaccggattgag
gagaagcgcaaacgcacttatgacgcctttaagagcatcgtcaaaaagagccctttcagt
gcagggacggcagattcccgcagccctcgccgcattgccgtgcccacccgaggcgtgccc
ctttcccacaaaacaggtggtctccccggcctgcctccccccgccgtccagccttacacc
tactcggccacgaccccgtccctcagcaccatcaacatggaggagttctctccgctgagc
ttcccccacgtgtccgccccggccccggcccccgccccgccgccccagcacccgcctccc
gcccccgccccccctcagcccggggaaggggtgctggcggaagccctgctcagcctgcag
tttgactccgacggcgacgggggcctgggggggctgctggacgaccccgacacggtctac
accagcctgggggccatcgacaactcggagttccagcagctgctgaaccagggcccggcc
ggggccgccgggaccgccgcggccgcccagggccccgccggggagcccatgctgatggag
taccccgagtccatcacccgcctcatgggggccccccagcgcccgcccgacggagccgtc
cccgccgtccccgccgtccccgccgccgccctccccaacgggtacctggttcccgaggag
gccttcccttctctggtggacatggacatcacagccttcctcaatcagatcaactcctaa

DBGET integrated database retrieval system