KEGG   Ornithorhynchus anatinus (platypus): 100074904Help
Entry
100074904         CDS       T01045                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00010  Glycolysis / Gluconeogenesis
oaa00053  Ascorbate and aldarate metabolism
oaa00071  Fatty acid degradation
oaa00280  Valine, leucine and isoleucine degradation
oaa00310  Lysine degradation
oaa00330  Arginine and proline metabolism
oaa00340  Histidine metabolism
oaa00380  Tryptophan metabolism
oaa00410  beta-Alanine metabolism
oaa00561  Glycerolipid metabolism
oaa00620  Pyruvate metabolism
oaa01100  Metabolic pathways
Module
oaa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100074904 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100074904 (ALDH2)
   00620 Pyruvate metabolism
    100074904 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100074904 (ALDH2)
   00561 Glycerolipid metabolism
    100074904 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100074904 (ALDH2)
   00310 Lysine degradation
    100074904 (ALDH2)
   00330 Arginine and proline metabolism
    100074904 (ALDH2)
   00340 Histidine metabolism
    100074904 (ALDH2)
   00380 Tryptophan metabolism
    100074904 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100074904 (ALDH2)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100074904 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100074904
NCBI-ProteinID: XP_007653633
Ensembl: ENSOANG00000004801
UniProt: F7FFC7
LinkDB All DBs
Position
2
AA seq 518 aa AA seqDB search
MLRAARLSNRLWARLVPRRALTAAALPAPNPQPQVLYDKIFIGNEWHDAISKKTFPTINP
STGEVICQVAEGGKEDVDKAVKAAKAAFRVGSPWRRMDASQRGNLLNRLADLIERDRTYL
ATLETLDNGKPYSISYLVDLDMVVKCLRYHAGWADKYHGKTIPIDGDFFSYTRHEPVGVC
GQIIPWNFPLLMLAWKLGPALATGNVVIMKVAEQTPLTALYVANLIKEAGFPPGVVNIIP
GYGPTAGAAIASHMEVDKVAFTGSTEVGHLIQVAAGKSNLKRVTLELGGKSPNIIMSDAD
MDWAVEQAHFALFFNQGQCCCAGSRTYVQEDVYPEFVERSVARAKSRVVGNPFDSQTEQG
PQVNEEQFKKILGYISAGKREGAKLLCGGEAAAERGYFIQPTVFGDVQDGMTIASEEIFG
PVMQILKFKTIEEVVERANNSKYGLAAAVFTKDLDKANYISQVLQAGTVWVNCYDVFGAQ
SPFGGYKMSGTGRELGEYGLQAYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgctgcaaggctgagcaacaggctgtgggcccggctcgtcccccgccgcgcc
ctgacggccgccgccctccccgcccccaacccgcagccccaggtcctctacgacaagatt
ttcataggcaatgagtggcatgatgccatcagcaagaaaactttccccacgatcaatccg
tctactggtgaggtgatttgtcaggtggctgaaggtggcaaggaagacgtggataaggca
gtaaaggcagccaaagctgcattccgggtgggctcgccctggcggcggatggatgcttcc
caacgtggaaacctgctgaaccgtctggcagacctgatcgagcgggaccggacctacttg
gcaaccctggagaccctggataatggcaaaccctattcaatctcctacctggtggacttg
gacatggtggtcaaatgccttaggtaccacgctggctgggctgataaataccatgggaaa
acaattccgatagatggagacttcttcagctatacccgccacgaacccgtcggtgtctgt
ggtcagatcattccgtggaactttccattgcttatgcttgcctggaaactgggaccagcc
ttggcaactgggaacgtcgtcataatgaaggtcgccgaacagactccccttactgccttg
tacgtggccaacttgatcaaagaggcaggcttccctcctggagttgtcaacattattcct
ggctatggcccaacagctggggctgccatcgcttcccacatggaagtggacaaagtggcg
ttcacaggctctacggaggttggccacctaattcaggtagctgcagggaagagtaacctc
aagagagtgactctggagctgggcggcaagagccccaacataattatgtcagatgccgac
atggactgggcagtggagcaggcccacttcgcactgttcttcaaccagggtcagtgctgc
tgcgctggctcccgaacctatgtgcaagaggacgtttatcccgaatttgtggagaggagc
gttgctcgggccaagtctcgcgtggttgggaacccctttgacagccagactgaacagggg
cctcaggtgaatgaggagcagtttaagaagatccttggctatatcagtgcggggaaacga
gagggggcaaaactgctctgcggaggcgaggccgctgctgaaaggggctacttcatccag
cccaccgtgtttggggacgtgcaggatggcatgaccattgcctcagaggagatctttgga
ccagtgatgcagattctgaagttcaagaccatcgaagaggttgtggagagagccaataac
tctaagtatgggctggctgcagctgtctttaccaaggatctggacaaagccaattatata
tcccaagtcctacaggccggcacggtatgggttaactgttacgatgtatttggtgcccag
agcccgtttggtggttacaagatgtcagggactggtcgggagcttggagagtatggcctt
caggcctatacagaagtgaaaacggtcaccatcaaggtccctcagaagaactcttaa

DBGET integrated database retrieval system