KEGG   Ornithorhynchus anatinus (platypus): 100075081Help
Entry
100075081         CDS       T01045                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01522  Endocrine resistance
oaa04068  FoxO signaling pathway
oaa04110  Cell cycle
oaa04115  p53 signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04152  AMPK signaling pathway
oaa04218  Cellular senescence
oaa04310  Wnt signaling pathway
oaa04340  Hedgehog signaling pathway
oaa04371  Apelin signaling pathway
oaa04390  Hippo signaling pathway
oaa04510  Focal adhesion
oaa04530  Tight junction
oaa04630  Jak-STAT signaling pathway
oaa04917  Prolactin signaling pathway
oaa04919  Thyroid hormone signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa04934  Cushing syndrome
oaa05160  Hepatitis C
oaa05162  Measles
oaa05163  Human cytomegalovirus infection
oaa05165  Human papillomavirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05167  Kaposi sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05210  Colorectal cancer
oaa05212  Pancreatic cancer
oaa05213  Endometrial cancer
oaa05214  Glioma
oaa05215  Prostate cancer
oaa05216  Thyroid cancer
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05220  Chronic myeloid leukemia
oaa05221  Acute myeloid leukemia
oaa05222  Small cell lung cancer
oaa05223  Non-small cell lung cancer
oaa05224  Breast cancer
oaa05225  Hepatocellular carcinoma
oaa05226  Gastric cancer
oaa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100075081 (CCND1)
   04340 Hedgehog signaling pathway
    100075081 (CCND1)
   04390 Hippo signaling pathway
    100075081 (CCND1)
   04371 Apelin signaling pathway
    100075081 (CCND1)
   04630 Jak-STAT signaling pathway
    100075081 (CCND1)
   04068 FoxO signaling pathway
    100075081 (CCND1)
   04151 PI3K-Akt signaling pathway
    100075081 (CCND1)
   04152 AMPK signaling pathway
    100075081 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100075081 (CCND1)
   04115 p53 signaling pathway
    100075081 (CCND1)
   04218 Cellular senescence
    100075081 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100075081 (CCND1)
   04530 Tight junction
    100075081 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100075081 (CCND1)
   04921 Oxytocin signaling pathway
    100075081 (CCND1)
   04919 Thyroid hormone signaling pathway
    100075081 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100075081 (CCND1)
   05206 MicroRNAs in cancer
    100075081 (CCND1)
   05205 Proteoglycans in cancer
    100075081 (CCND1)
   05203 Viral carcinogenesis
    100075081 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100075081 (CCND1)
   05212 Pancreatic cancer
    100075081 (CCND1)
   05225 Hepatocellular carcinoma
    100075081 (CCND1)
   05226 Gastric cancer
    100075081 (CCND1)
   05214 Glioma
    100075081 (CCND1)
   05216 Thyroid cancer
    100075081 (CCND1)
   05221 Acute myeloid leukemia
    100075081 (CCND1)
   05220 Chronic myeloid leukemia
    100075081 (CCND1)
   05218 Melanoma
    100075081 (CCND1)
   05219 Bladder cancer
    100075081 (CCND1)
   05215 Prostate cancer
    100075081 (CCND1)
   05213 Endometrial cancer
    100075081 (CCND1)
   05224 Breast cancer
    100075081 (CCND1)
   05222 Small cell lung cancer
    100075081 (CCND1)
   05223 Non-small cell lung cancer
    100075081 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100075081 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100075081 (CCND1)
   04934 Cushing syndrome
    100075081 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100075081 (CCND1)
   05162 Measles
    100075081 (CCND1)
   05160 Hepatitis C
    100075081 (CCND1)
   05163 Human cytomegalovirus infection
    100075081 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100075081 (CCND1)
   05169 Epstein-Barr virus infection
    100075081 (CCND1)
   05165 Human papillomavirus infection
    100075081 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100075081 (CCND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 100075081
NCBI-ProteinID: XP_028916149
Ensembl: ENSOANG00000007416
LinkDB All DBs
Position
3
AA seq 292 aa AA seqDB search
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKNRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPLAEENKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGSSNTFLTYQRLTRFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHSVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaagtggaaaccatcaggagagcctacctagacgcc
aaccttctgaatgaccgagtcctgcagaccatgctgaaggcagaagagacctgttcgccc
tctgtgtcctactttaaatgtgtgcagaaagaaatcttgccgtatatgcggaaaattgtt
gcaacttggatgttggaggtttgcgaagagcagaagtgtgaagaggaggtgtttcccctg
gccatgaattatctggataggtttttgtcgctggaacccctgaagaagaaccgattgcaa
ctgctgggagctacctgcatgtttgtggcttcaaaaatgaaggaaactatccctctgacc
gcagagaaactgtgcatttataccgataattccattcgacctgacgaattactgcaaatg
gagctgctgttggtaaataagctgaagtggaatctggccgccatgactccacacgatttc
attgaacatttcctttctaaaatgcccctggctgaagaaaacaaacagatcatccgcaaa
cacgcccagacttttgtggctctctgcgctacagatgttaagttcatttcaaatccaccc
tccatgattgcggcaggtagcgtggtagcagcagtacaaggtctccacttgggaagttct
aacacttttctcacctatcaacgcctcacacgcttcctatcacaagttattaaatgtgac
ccggattgtttacgagcctgccaagaacagatcgagtcccttctagaatccagtctgcgt
caggcacagcagcacagcgtatcttcagaaacaaagactgttgaagatgaagcagacctc
tcttgcacacccactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system