KEGG   Ornithorhynchus anatinus (platypus): 100075167Help
Entry
100075167         CDS       T01045                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oaa01002]
    100075167 (TMPRSS9)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100075167 (TMPRSS9)
Peptidases [BR:oaa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100075167 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA
Motif
Other DBs
NCBI-GeneID: 100075167
NCBI-ProteinID: XP_016082904
LinkDB All DBs
Position
Un
AA seq 1030 aa AA seqDB search
MEPEEVGLKPVPAIGKGQLGANHTCCKKTVAIVTASGVALVSIGLLFLAFLSSQDLNFEH
MAELRGIQYESSLQKETSDYFRALTPALELLFVSSFQRTKLEASCVGCTVLSYRDGNSSV
LVHFRLRFLSQTPWSLNSRLEEEILQQGLALRFQEQSIPVATYGSISSAALMGSKEVSFA
EIAFKSDCGVRPAVQISNRIVGGVDASKGEFPWQVSLRENNEHFCGAAILNEKWLVSAAH
CFNEFQDPTAWMAFAGTTSLSGSDGGTVKVGISQIVKHPFYNMDTADFDVAVLELRHPLP
FNKRIQPVCLPAATHIFPASKRCLISGWGYLKEDFCKYGWGDRAGRSGDSGGPLVCEESL
GKFFLAGIVSWGVGCAEAQRPGVYARVTELRNWISEAISSPSTTRAASATRALSTPSGAR
ASTPESPTVTGTTLLPGTGLGATILPRGTTSRPQASRQLVTWGKGGDRGGRFKKQKLGRV
GTCEKTHCWLSILETGGLGNVCLGSCLRSTKVEYVQAYVGTTTLSGTDGSAVTINIKRLV
LHPSYNPMILDFDVAVLELARPLLFNKYVQPVCLPLAIQKFPVGRKCVISGWGNVHEGNA
TKPEVLQKASVGIIDQKTCSVLYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEEAPGV
FYLAGIVSWGIGCAQAKKPGVYSRMTKLKDWIVDTMSLSLHTTSVPSTEKTPSVPGTTPG
TTPGRTATSLTSRTTTPKPASKPTSKPTGKPALKPTGPPTTASTKSKTPLPLLKTTETVK
PTQLPDCGATPAATFTKIVGGSSAVRGEWPWQVSLWLRRKEHKCGAVLIADKWLLSAAHC
FDIYSDPKMWVAFLGTPFLSGIDGRIEKVFRIHKHPFYNVYTLDYDVALLELSTPVRFTS
VMKPICLPDHSHLFSEGTNCYITGWGSTREGGVMSKHLQKAMVNIISEQTCKKFYPIQIS
SRMLCAGFPQGGVDSCSGDAGGPLACREPSGKWFLAGVTSWGYGCARPYFPGVYSKVTAV
RGWIGQNIKL
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atggagccagaagaggtcggcttaaagcctgtgcctgccataggaaagggacaactaggt
gccaaccacacctgctgtaagaaaacagtggctattgtgacggccagtggcgtggctttg
gtttccataggactcctctttctggctttcctttcttcccaggacctcaattttgaacat
atggccgaactgagagggattcagtatgagagcagtttacagaaggagacctccgactat
ttcagagcattgacacctgctctggagttgctgttcgtgagcagtttccagaggaccaag
ttggaagcaagttgtgtgggctgcaccgtgctgagttacagggatgggaactcgagcgtc
cttgtccatttccgcctgcgtttcctgtcccagaccccgtggtccctgaactcaagacta
gaggaggagattcttcagcaaggtttggccttgaggttccaggagcagagcatccccgta
gccacctatggttccatctcctcggctgcactgatggggtccaaggaggtgtcttttgct
gaaatcgcttttaagtcagactgtggagtccgacccgccgtgcagatatccaacaggatc
gtggggggtgttgacgcctctaagggtgagtttccttggcaggtcagcctccgggaaaac
aatgagcacttctgtggagctgcgatcctcaatgaaaaatggctggtgtctgcagctcac
tgtttcaacgagttccaggacccgaccgcctggatggcttttgctgggacaacatccctc
agtggctccgatgggggcactgtgaaggtgggcatatctcagatcgtcaagcaccccttc
tacaacatggacacagccgactttgacgtggccgtgctggaactgcgtcaccccctgccc
ttcaacaaacgcatccagccagtgtgccttcctgcagccacccacatcttccccgcgagc
aagaggtgcctcatctcgggctggggctacctcaaggaggatttctgtaagtatggctgg
ggtgaccgtgcgggacgctcgggtgattcgggagggcccctggtgtgtgaggagtctctg
ggcaagttcttcctcgccggcatcgtgagctggggggttggctgtgcggaggctcagcgg
cccggggtctacgcccgagtgaccgagctccggaactggatctcggaggccatctcgagt
ccctctaccaccagggcagcctctgctactcgtgccctctccacccccagtggggcccgg
gccagcaccccagagagccccaccgtcaccgggaccacactgcttcccggcacggggctg
ggcgccaccatcctgcctcgaggcaccacatccaggccacaagctagcaggcagcttgtg
acctgggggaagggtggtgaccggggtgggagatttaagaaacagaaactgggtcgtgtg
gggacctgtgagaagactcactgctggctgtctatcctggagactggtgggttggggaat
gtctgtctgggctcctgtctccgcagcacaaaggtggaatatgttcaagcctacgtggga
accacaactctctcggggacggatggcagtgccgtgacgatcaacatcaagagactagtg
ctccacccctcctacaatcccatgatcctggactttgatgtggccgtgctagaattagcc
agacctctcctcttcaacaagtatgtccagcccgtctgtctcccgctggccatccagaag
ttccccgtaggccggaagtgtgtgatttctggctgggggaatgtccacgaaggcaacgcc
accaaacctgaggtcctgcagaaagcatctgtgggcatcattgaccagaagacttgcagc
gtcctctataacttctccctcacagaccgcatgatctgtgccggtttcctggaggggaag
gtcgattcgtgtcagggtgactccggagggcccctggcgtgtgaggaagctcctggagtg
ttctatctggcagggattgtgagctgggggattggatgtgctcaagctaagaagcctggg
gtctactcccgaatgaccaagctcaaagactggatcgtggacaccatgtccctttccctc
cataccacctccgtcccgtccactgagaaaacacccagcgtgcccggtaccactccagga
acgactccgggcaggacagccacgagtctcacgtctagaacgaccacgcccaagccggcc
agcaagcccacctccaagccgactggcaaacccgccctgaaaccgaccggcccacccacc
accgcgagtaccaagagtaaaacaccacttccgctccttaaaactaccgaaaccgttaaa
cccacccagcttccagactgtggtgccaccccggcggcgactttcactaagatcgtgggc
ggcagcagcgcggtccggggtgagtggccctggcaggtcagcctatggctgcgccgcaag
gaacacaagtgcggggccgtcctcatcgctgacaagtggctgctctcggcagctcactgt
tttgacatttacagtgaccccaagatgtgggttgccttcctggggaccccttttctgagt
ggaattgatgggaggattgagaaagtcttccgcatccacaaacacccattttacaacgtc
tataccctggactatgacgtggcccttttggaactgtccacgcccgtgagattcaccagt
gtaatgaagccaatctgtctcccagatcactcccacctcttcagcgaaggaacaaactgt
tacatcacgggctggggctccaccagggaaggaggtgtgatgtcaaagcacctgcagaaa
gcaatggtgaacatcatcagtgaacagacgtgcaagaagttttaccccatccagatcagc
agcaggatgctgtgtgccggcttcccgcagggaggtgtggacagctgctcgggtgatgcc
ggaggccccttggcctgcagggagccctcggggaagtggttcctcgccggagtcacgagc
tggggctacggctgcgccagaccctatttccccggggtctattccaaagtgactgctgtg
agaggctggattgggcagaacatcaagttgtga

DBGET integrated database retrieval system