KEGG   Ornithorhynchus anatinus (platypus): 100075386
Entry
100075386         CDS       T01045                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00220  Arginine biosynthesis
oaa00330  Arginine and proline metabolism
oaa01100  Metabolic pathways
oaa04020  Calcium signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04146  Peroxisome
oaa04371  Apelin signaling pathway
oaa04926  Relaxin signaling pathway
oaa05010  Alzheimer disease
oaa05014  Amyotrophic lateral sclerosis
oaa05022  Pathways of neurodegeneration - multiple diseases
oaa05133  Pertussis
oaa05140  Leishmaniasis
oaa05142  Chagas disease
oaa05145  Toxoplasmosis
oaa05146  Amoebiasis
oaa05152  Tuberculosis
oaa05200  Pathways in cancer
oaa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100075386 (NOS2)
   00330 Arginine and proline metabolism
    100075386 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100075386 (NOS2)
   04066 HIF-1 signaling pathway
    100075386 (NOS2)
   04020 Calcium signaling pathway
    100075386 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100075386 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100075386 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100075386 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100075386 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100075386 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100075386 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100075386 (NOS2)
   05152 Tuberculosis
    100075386 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100075386 (NOS2)
   05145 Toxoplasmosis
    100075386 (NOS2)
   05140 Leishmaniasis
    100075386 (NOS2)
   05142 Chagas disease
    100075386 (NOS2)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100075386 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100075386
NCBI-ProteinID: XP_028937415
LinkDB
Position
17
AA seq 1144 aa
MACPWNIWFKPKPCHEGFDAKKDINNNVEKATFKVSSLGKQDDARLPGLNPSRNEPPRPP
LAMGKKSPEYHAKPRLPTQGCTRHVRIKNWGNGMTFEDTLHHKAKGDLTCTVKSCQGAIM
NPKTLVRGPRDRPTPREELLPQAIEFINQYYGSFKEAKIEQHLARVEAVTKEIETTATYQ
LKEEELIYATKQAWRNAPRCIGRIQWSNLQVFDARKCTTAKEMFEHICRHIRYSTNSGHI
RSAITIFPQRSDGKHDFRIWNSQLVRYAGYLMPDGSIMGDPACVEFTQLCMDLGWEPNFG
RFDVLPLILQANGQDPELFEIPPELILEVAMEHPKYEWFQELDLKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLDTHKTASLWKDRAVIEVNV
AVLHSFQKQNVTITDHHSAADAFMKYMQNEYSSRGGCPADWVWLVPPISGSLTPVFHQEM
LNYILSPFYYYQIEAWKTHIWQDEKRRPKRRVIKFNILVKAVLFATVLMRKTLEARIKAT
VLYASETGKSETLARNLGDLFNCAFNTKVVCMDEYNLNNLEKEKLLLVVTSTFGNGNAPG
NGEKLKKSLFTLKELNNKFRYAVFGLGSSMYPQFCAFAHEVDQKFSQLGACQLASTGEGD
ELSGQEEAFRSWAVDTFKEACETFDIRGKHKVHIPRSYITKENWNPQNFRIVPVSQPLDL
SRALSSLHAQKVLSMKLKSRQNLRSLNSSRTTLLVQLSGERSQEVRYHPGDHLGVFPGNP
PDLVQGIMGRVQDAPPTHQAIRLETCRQSGDYWTSIKKLPPCSLSQALTYFLDLTTPPTQ
LLLKKLAQLASKDGERQRLEALCQTSEYRPWKFSNSPTFLEVLEEFPSIEVSTAFLLTQL
PLLKPRYYSISSSQVLTPKEIHLTVAVVSYRTRGGQGPLRHGVCSTWLSRLEPQDSIPCF
VHSASGFQLPENPSQPCILIGPGTGIAPFRSFWQQRLFDKETKGVKTGRMTLVFGCRSHT
DHLYREEAQEMKKKGVLREVYTAYSRQPGQPTVYVQDILRNSLAGEVHRVLHEDGGHVYV
CGDGRMGRDVARTLKEILASKLGLSQEQAEDYFFQLKDQRRYHEDIFGTAFPYEGGKGHS
AVET
NT seq 3435 nt   +upstreamnt  +downstreamnt
atggcatgcccctggaatatttggttcaaacccaaaccttgccacgaaggcttcgatgca
aaaaaagatatcaacaacaatgtggaaaaggccaccttcaaagtcagcagtctgggaaaa
caggacgatgccagattacccggcctcaacccgtctcggaacgagccccctcggcccccg
ctggcgatgggcaagaaatctcctgagtaccatgccaagccccgccttcctacacagggc
tgcacgaggcacgtcaggatcaaaaactggggtaacggaatgaccttcgaggacacgctc
catcacaaagccaagggggatctcacctgtacggtgaaatcttgtcagggggccatcatg
aatcccaagaccttggtgagaggtcccagagaccggccgaccccacgagaagaacttcta
cctcaagccattgaattcatcaaccagtattatggttccttcaaagaggcaaaaatagag
caacatctggccagggtggaagccgtaacaaaagagatagaaacaacagcaacttatcag
ctgaaagaagaagaactcatctacgcgaccaaacaggcctggcgtaatgcgccccgatgc
attggcaggatccagtggtccaacctccaggtgtttgatgcccggaagtgtaccacagcc
aaggagatgtttgagcatatctgcaggcacatccggtattcgaccaacagcggccacatc
agatctgccatcaccatcttcccccagcggagcgacgggaagcacgacttccggatctgg
aacagccagctggtccgctacgccggctacttgatgcccgacggctccatcatgggggac
ccagcctgcgtggaattcacccagctgtgcatggatctgggctgggaacccaattttggc
cgctttgatgtgttgccactgatcctgcaagccaatggccaggaccccgagctctttgaa
atcccaccagaactgatcctggaggtggccatggaacatcccaagtacgagtggttccag
gagttggatctgaagtggtacgccctgccggccgtggctaacatgctgctggaggtagga
ggcctggagttcccaggatgccccttcaacggctggtacatgggcaccgagattggcgtc
cgggacttctgcgacgtacagcgctacaacatcctggaggaagtaggaaggagaatgggc
ctggacactcacaagacggcatctctgtggaaggaccgagcggtgattgaagttaacgtg
gcagtgcttcacagtttccagaaacaaaacgtgaccatcacagaccaccattctgctgca
gatgccttcatgaagtacatgcagaacgagtacagctcccgggggggctgccccgccgac
tgggtctggctggtacccccgatctcgggcagcctcactccggtatttcaccaggagatg
ctcaactacatcttgtctcctttctattactaccagatagaggcttggaaaacacacatc
tggcaggatgagaagaggaggcccaagagaagagtcatcaagttcaacatcttggtcaag
gctgtcctttttgccactgtgctgatgcgtaagaccctggaagccaggatcaaagccaca
gtgctatatgcctcagagactgggaaatcagaaaccctggccaggaacctgggagattta
ttcaactgtgctttcaacaccaaggttgtctgcatggatgagtataacctgaacaacttg
gagaaggagaagctgctgctggttgtgaccagcacttttgggaacggaaatgctccaggc
aatggagagaaactgaagaagtccctgttcactctgaaagagctcaacaacaaattcagg
tatgctgtgtttggcctcggctctagcatgtacccccagttctgtgccttcgctcatgag
gtcgaccagaagttttcccagctgggggcctgccagcttgcttccacgggagagggagat
gaactcagcgggcaggaagaggccttccggagctgggcagtggacactttcaaggaggcc
tgtgaaacctttgacatccggggaaagcacaaggttcacatccccagatcttacatcact
aaggaaaactggaatccccaaaacttcaggattgtgccagtctcccaacctttggacctg
agcagagctctgagcagtctgcacgcccagaaggtgctttccatgaaactcaaatcccgg
cagaatctccggagcttgaactccagccgcacgacccttctggtccagctttccggagag
aggagccaggaagtgcgctatcacccgggagaccaccttggggttttccctggaaacccg
ccagatttagtccagggcatcatggggcgcgtccaggatgctcccccgacacatcaggcc
atccggctggaaacctgcaggcagagcggcgactactggaccagcatcaagaaactgccc
ccctgctcactctcccaggccttgacatatttcctggacctcaccaccccgcccactcag
ctcctgctgaagaaactagcccagctggccagcaaggatggggagagacagaggctggag
gccctgtgtcagacctcagagtatcgcccgtggaagttctccaacagccccaccttcctt
gaggtcctggaagagtttccatcgatcgaggtctccaccgccttcttgctcacccagctg
cccctgctgaagcctcgctactactccatcagctcctcccaggtcctcactcccaaggaa
atccacctgactgtggccgtggtcagctaccggaccagaggagggcagggccccctccgc
catggggtctgcagcacgtggctcagcaggctggagccccaggacagcatcccctgcttc
gtgcacagtgccagtgggttccagctgcccgagaacccatcccagccctgcatcctgatt
ggccccggcacagggattgcccccttccgcagtttctggcagcagcgcttgttcgacaag
gagacaaaaggcgtgaagacgggccgcatgaccttggtgttcggctgccgctcccacacg
gaccacctgtaccgagaggaggctcaggagatgaagaagaagggagtgctccgggaggtc
tacaccgcctactcccgccagccaggccagcccacagtctacgtccaggatatcctgcgg
aacagcctcgcgggcgaggtgcacagggtgttgcatgaagatggcggccacgtgtacgtc
tgtggagacgggaggatgggccgggacgtggctcggaccctgaaggagattttggcctcc
aagctgggcctgagtcaggagcaggctgaagattatttcttccagctgaaggaccagagg
cgataccacgaagatatctttggaaccgcctttccctatgaggggggaaaaggacacagc
gctgtcgaaacctga

DBGET integrated database retrieval system