KEGG   Ornithorhynchus anatinus (platypus): 100077642Help
Entry
100077642         CDS       T01045                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00250  Alanine, aspartate and glutamate metabolism
oaa00410  beta-Alanine metabolism
oaa00430  Taurine and hypotaurine metabolism
oaa00650  Butanoate metabolism
oaa01100  Metabolic pathways
oaa04727  GABAergic synapse
oaa04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100077642 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100077642 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100077642 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100077642 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100077642 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100077642 (GAD1)
Enzymes [BR:oaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100077642 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase OKR_DC_1 SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 100077642
NCBI-ProteinID: XP_001514987
LinkDB All DBs
Position
Un
AA seq 708 aa AA seqDB search
MASSAPSSSSSSSNAGQDPNPTNLRPTIHPLPWPEPRFSADPRGAAEEPVRAVIEEGEEG
KRLPKTGSLQSEGMQGPSRFGAESGAQSGRSSTCRQAGGGGARMLWKSLRRAGTREAGKC
GPKQQSQVSTTQPRSLFPSCVLAGPIPLLQPPGGLDQPRWSLCFLQRTNSLEEKSRIVSA
FKERQSSKNQLACENSEQDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLN
YVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPR
FFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWSNKDGDG
IFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFGTD
NVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIADLCEKY
NLWLHVDAAWGGGLLMSRKHRHKLSGVERANSVTWNPHKMMGVLLQCSAILVREKGILQG
CNQMCAGYLFQQDKQYDISYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQVNKCLEL
AEYLYAKIKNREEFEMVFKGEPEHTNVCFWYIPQSLRGIPDSEERREKLHRVAPKIKALM
MESGTTMVGYQPQGDKANFFRMVISNPAATKSDIDFLIEEIERLGQEL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttcggcaccttcctcgtcgtcctcctcctccaacgcggggcaggaccccaac
cccaccaacctgcgccccacaatccacccccttccctggcccgaaccccggttctcggct
gaccctcggggggccgcggaggagccggtgcgagcggtcatcgaagagggagaggaggga
aagaggctgccgaaaaccgggtcgctccaatctgagggtatgcaaggtccttcccgtttt
ggggcggaaagtggagcccagagtgggcgcagcagcacctgtcgacaggcaggtggcgga
ggtgctaggatgctgtggaaaagcctgaggagggcgggcacgagggaagctggaaaatgt
ggacccaagcagcagtcccaggtctccacaacgcagccccgcagcctcttcccaagttgc
gtgctggcagggcccatccctctcctgcagcccccgggaggattggatcagccgagatgg
agcctgtgcttcttgcaaagaaccaacagcctggaggagaagagccggattgtgagcgcc
ttcaaggagaggcagtcctcaaagaaccaactggcgtgtgagaatagcgagcaggacgct
cggttccggcgcaccgagacagacttctccaacctctttgccagagacctcctgccggcc
aagaatggggaggagcagacggtgcagttccttctggaggtggtggacatccttctcaac
tacgtgcgcaagacatttgatcgctccaccaaggtgctggacttccaccacccacaccag
ctgctggaggggatggagggcttcaacttggaattgtcagatcaccctgagtccctggag
cagatcctggtagactgcagagacaccctgaaatatggtgtccgcacaggtcatcctcga
tttttcaaccaactctccactggactggatattattggcttagctggtgaatggctgacg
tcaactgcaaacactaatatgtttacatatgaaattgcaccagtgtttgtcctcatggaa
caaatcacacttaaaaaaatgagagaaattattggatggtcaaataaggatggtgatgga
atattttcacctgggggagctatatctaatatgtacagcatcatggctgcccgttacaaa
tattttcctgaagtcaaaaccaaaggcatggctgccgttcccaaactggtcctctttacc
tcagaacatagccattattcgataaagaaggctggagcagcacttggctttggaactgac
aatgtaattttgataaagtgcaatgaaagagggaaaataatcccagctgatttggaggca
aaaattcttgaagccaaacaaaagggatatgttcctctttacgtgaatgcaactgcaggt
accacagtgtatggagcttttgacccaattcaagagattgcagacctatgtgaaaaatat
aacctttggctccatgtagatgctgcctggggaggtgggcttctcatgtccagaaagcat
cgtcataaactcagtggcgtagaaagggccaactcggttacctggaacccacacaaaatg
atgggagtcttgttgcaatgctctgccattctcgtcagagaaaagggaatactccaagga
tgcaatcagatgtgtgccgggtatcttttccagcaagacaagcagtacgatatttcgtac
gacactggagacaaggcaatacagtgtggccgtcatgtggacatttttaagttctggttg
atgtggaaagccaagggaacagtgggatttgaaaatcaggtcaacaaatgcttagaattg
gcagaatatctctatgcaaaaataaaaaacagagaagaatttgagatggtttttaaaggc
gagcctgagcacacaaacgtttgcttctggtatattccacagagtctcaggggcatacca
gacagtgaggagagacgggaaaagctacacagggtggcgccaaaaatcaaagccctgatg
atggagtcaggtaccacaatggttggatatcaacctcagggagacaaagccaacttcttc
cgtatggttatctcaaatcccgcagctactaaatctgacatcgacttccttattgaagaa
atagaaagattggggcaggagctgtaa

DBGET integrated database retrieval system