KEGG   Ornithorhynchus anatinus (platypus): 100077907Help
Entry
100077907         CDS       T01045                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00020  Citrate cycle (TCA cycle)
oaa00310  Lysine degradation
oaa00380  Tryptophan metabolism
oaa01100  Metabolic pathways
oaa01200  Carbon metabolism
Module
oaa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100077907 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    100077907 (OGDHL)
   00380 Tryptophan metabolism
    100077907 (OGDHL)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100077907 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxogl_dehyd_N OxoGdeHyase_C GGA_N-GAT
Motif
Other DBs
NCBI-GeneID: 100077907
NCBI-ProteinID: XP_007658883
Ensembl: ENSOANG00000013228
LinkDB All DBs
Position
3
AA seq 943 aa AA seqDB search
MLLRLLAARLYTQCAGLLAKRDVPRQGGGGCGSRRASSGATESFLSGTSSNYVEEMYFAW
LDNPQSVHKSWDAFFRNASAGAPPGHAYQRPLSVSPEHRAKLIESHGLARSQAKTDKLVE
DHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLHESDLDKV
FQLPTTTFIGGSESTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFEMPGVMK
FSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENV
ILGMPHRGRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERVNRVTNKN
ITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDTSGKKVMSILVHGDAAFAGQGVVYETFH
LSDLPSYTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADNPEAVIY
VCGVAAEWRNTFNKDVIVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLI
AEGTVTLQEFEEEIAKYDRICEEAYTRSKDKKILHIKHWLDSPWPGFFNLDGEPKSMACP
PTGIPEDMLTHIGTVASSVPLEGFVIHGGLSRILRSRVEMIKNRTVDWALAEYMAFGSLL
KEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGV
LGFELGFAMASPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEG
MGPEHSSARPERFLQMSNDDSDAYPEFRDDFEVGQLYDCNWIVVNCSTPANYFHVLRRQI
LLPFRKPLIIFTPKSLLRHPEAKSGFDEMVSGTSFRRVIPECGAAAQAPAEVKRLILCTG
KVYYDLVKERKNQDLEKQVAITRLEQVRVESCYELFGLIISLV
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgcggttgctggcggcgcggctgtacacgcagtgcgccgggctcttggcgaag
cgggatgtgcccaggcaggggggaggagggtgcggctcccgccgggcctcctcgggagcc
accgaatccttcctgagcggcaccagctccaactatgtggaggagatgtacttcgcctgg
ctggacaacccccagagcgtccataagtcgtgggacgctttcttccggaacgccagcgcc
ggcgccccccccggccacgcctaccagaggcctctgtccgtcagtccggagcaccgagcc
aagctgattgagagccatgggctggcgaggagccaagccaagacggacaagctggtggag
gaccacctggctgtacagtcgctgatccgggcctatcagatccgagggcatcatgtggcc
cagctggatcccctgggcatcctagatgccgacctggattcatttgtgccctcagatctg
atcacgaccatcgacaaactggctttctatgacctgcacgagtccgatctggacaaggtt
ttccagctgcccacgaccaccttcattgggggctctgagagcactctgtccctacgtgag
atcatcaggcgtttggagagcacctactgccagcacatcggcttggagttcatgttcatc
aatgacgtggagcagtgtcagtggatccggcagaagttcgagatgcccggggtgatgaag
ttcagcagcgaggagaagaggactctgctggcccggctggtgcgctccatgaggtttgaa
gatttcctggcgcggaagtggtcctcggagaagagatttgggttggaaggctgcgaggtc
atgatccctgccctcaagaccatcatcgacaaatccagcgagatgggcatcgagaatgtg
atcctggggatgccccacaggggcaggctgaatgtgttggccaacgtcatccggaaggag
ctggagcaaatcttctgccagtttgaccccaagcttgaggcggctgatgagggctctggg
gatgtgaagtatcacctggggatgtaccacgagcgggtcaaccgggtcaccaacaagaac
atcaccctgtcgctggtggccaatccctctcacctggaggccgtggatccagtggtgcag
ggcaagaccaaggctgagcagttctaccgaggggacacctcagggaagaaggtcatgtcc
atcctagtccatggggacgcggcctttgctgggcagggcgtggtgtacgagactttccac
ctcagcgatctaccgtcctacaccactaatggcacgatccacgtcgtggtcaacaaccag
attggcttcaccacagacccccggatggctcgctcctccccctacccaacagacgttgcc
cgcgtggtcaacgcccccatcttccacgtgaacgcggacaaccccgaggccgtcatctat
gtgtgcggagtcgcggctgagtggcggaacaccttcaacaaggacgtcatcgtggacctg
gtctgctaccgccgccgaggccacaacgagatggacgagcccatgttcacccagcccctc
atgtacaagcagatccacaagcaggtgccggtgctcaagaagtatgcagacaagctgatc
gcagaagggaccgtgaccctgcaggagtttgaggaggaaattgccaagtatgaccggatc
tgtgaggaggcttacactaggtcgaaggataagaaaattctgcacattaagcactggctg
gattccccatggcctgggttcttcaacctggacggcgaacccaagagcatggcctgtccc
ccgactgggatcccggaagacatgctgacgcatatcggcacagtggccagctccgtgccc
ctggagggtttcgtgatccacggaggtctctctcggatcctgaggagccgtgtggagatg
attaagaatcggacggtggactgggctttggccgagtacatggccttcggctccctgctg
aaggaggggatccatgtccgactaagcgggcaagacgtggagcggggcactttcagccac
cggcaccacgtgctgcacgaccaggaagtggaccggaggacctgcgtgcccatgaaccac
ctctggccggaccaagccccgtacacggtctgcaacagctccctctccgagtacggcgtc
ctgggctttgaacttggctttgccatggcaagccccaacgcgttggtgtgctgggaagcc
caatttggtgacttccacaacaccgcccagtgcatcatcgaccagttcatcagctcgggc
caggccaagtgggtccgccacaatggcatcgtcctgctcttgcctcacggcatggagggc
atgggaccagaacactcatcggctcgaccggagaggtttctacagatgagcaatgacgac
tcggatgcctacccggagttccgcgatgactttgaggtgggccagctgtacgactgcaac
tggatcgtcgtgaattgctccaccccggccaattatttccatgtgctcaggaggcagatt
ctgctcccgttccggaagccgctgatcatcttcactccaaagtccctgttgagacacccg
gaagcgaagtctggcttcgatgagatggtttccggcaccagcttccggagggtcatcccc
gagtgtggggccgccgcccaggccccggcggaggtgaaacggctgattctctgcacgggg
aaggtctactatgacctggtgaaggaaaggaagaaccaagacctggaaaagcaagtggcc
atcactaggctggagcaggtcagggtggagagctgttatgagctgtttggtttgattatt
tcattagtgtga

DBGET integrated database retrieval system