KEGG   Ornithorhynchus anatinus (platypus): 100078239
Entry
100078239         CDS       T01045                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04014  Ras signaling pathway
oaa04390  Hippo signaling pathway
oaa04392  Hippo signaling pathway - multiple species
oaa05200  Pathways in cancer
oaa05206  MicroRNAs in cancer
oaa05219  Bladder cancer
oaa05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100078239 (RASSF1)
   04390 Hippo signaling pathway
    100078239 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100078239 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100078239 (RASSF1)
   05206 MicroRNAs in cancer
    100078239 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100078239 (RASSF1)
   05223 Non-small cell lung cancer
    100078239 (RASSF1)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 100078239
NCBI-ProteinID: XP_028907171
LinkDB
Position
X1
AA seq 367 aa
MSTEPELIELRELAPERRAELGRGPRGPGRLERANALRIAPGRALDLLSSGGQVRLPGGH
GDPRLTAGPGRGHSFRPSGPGTQTWCDFCGDFIWGVIRKGLQCTHCKFTCHYRCRALIRL
DCCGSWDPGSEPALERDTNVDEQLECEKKEEKEKPVLSQKEIEQKIKEYNSQINSNLFMS
LNKDGSYTGFIKVQLKLVRPVSVPATKKPPTLHDAKRPAGKSQAVKRRTSFYLPKDTVKH
LHVLSHTRAREVIEALLRKFLVVDNPRKFALFERAERHNQVYLRKLEDDEQPLRLRLLAG
PSDKTLSFVLKENETGEVNWDAFSMPELHNFLRILQREEEEHVRQILQKYSHCRQKMQEA
LGARPLG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtcgacggagccggagctgatcgagctgcgagagctggccccggagcgacgggccgag
ctgggccgggggccgcggggccccggacgcctggagcgggccaacgcgctgcgcatcgcc
ccgggccgcgctctggacctgctgagcagcgggggccaggtccgcctgccggggggccat
ggcgacccccggctgacggcgggcccgggccgcggccactctttccgcccgtcggggccc
ggcacccaaacttggtgcgacttctgcggggacttcatctggggcgtcatccgcaaggga
ctgcagtgcacccactgcaagttcacgtgccactatcgctgccgtgccctgatccgtctg
gactgctgtggctcctgggacccgggctctgagcctgcactggagagagataccaatgtg
gatgagcaattggagtgcgagaagaaggaggagaaagagaagccggtcttatcgcaaaaa
gagattgagcagaagatcaaggagtacaacagccagatcaacagtaacctcttcatgagc
ctgaacaaagatggctcctacaccggcttcattaaggtgcagctgaagttggtgcgcccc
gtttccgtgcccgctaccaagaagccgcccaccctgcacgatgccaagcggccagctggg
aagagccaggctgtgaagcgccgcacctccttctacttgcccaaggacacagtcaagcac
ctgcacgtgctctcccacacccgagcccgtgaggtcatagaggctctactccgcaagttc
ctggtggtggacaacccccgcaagttcgccctctttgagcgggctgagcgccataatcag
gtgtacctgcggaagctggaggacgacgagcagcccctgcgcttacgcctgctggctggg
cccagtgacaagaccctgagttttgtcctgaaggagaatgagacaggggaagtgaactgg
gatgcattcagcatgccagagctacataacttcctgcgcatcctacagcgggaggaggaa
gagcacgtgcggcagatcctgcagaagtactcccattgtcgtcaaaagatgcaggaggca
ttgggggcccgcccccttggatga

DBGET integrated database retrieval system