KEGG   Ornithorhynchus anatinus (platypus): 100079324Help
Entry
100079324         CDS       T01045                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00052  Galactose metabolism
oaa00500  Starch and sucrose metabolism
oaa01100  Metabolic pathways
oaa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100079324 (GAA)
   00500 Starch and sucrose metabolism
    100079324 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100079324 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oaa04147]
    100079324 (GAA)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100079324 (GAA)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100079324 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil GHL15
Motif
Other DBs
NCBI-GeneID: 100079324
NCBI-ProteinID: XP_007656054
LinkDB All DBs
Position
Un
AA seq 821 aa AA seqDB search
MAGEGPPQSWPPASRGVSRTCALTALALTTLLWASLLRLPGAVLHHPASASPGPGDSDRA
RREVRGRTGAPGGQDPARCAVPPDARFDCAPEKPVSRKECQDRGCCYAPGGAAPRGAQVW
QPWCFFPPDFPTYRLRNLTVTPGGYNATLTRSNRSFFPRDVLTLQLKVVLENQARLHFTI
KDPANQRYEVPLETPKVSGRAPSTLYDVDFSCDPFGLIVRRKSNDLVLLNTTVAPLFFAD
QFLQLSTSLPSHYVTGLGEHQTPLILSTNWTKLTLWNRDMAPAPGANLYGSHPFYLVLEE
SGKAHGVFLLNTYAMYVVLQPTPALTYRTVGGILDFYVFLGPEPGSVVRQYLEVVGYPLL
PPYWALGFHLCRWGYSSTTTTREVVENMTAAHFPLVEXXXXIDYMDAKKDFSFNNDTFRD
FRAMVXEYHRGGRRYVMMDPAISSSGAAGSYGPFDEGLKRGVFITNKTGQPLIGKVWPGA
TVFPDFTNPETRLWWHDMVADFHRQVPFDGMWIDMNEPSSFVDGSVDGCPDTQLDDPPYV
PGVVGGSLRAATICASSCQYLSSHYNLHNLYGLSEAVASHDALVKVRGKRPFVISRSTFA
GHGHYAGHWTGDVWSNWDQLYYSVPGVLLFNLFGVPLVGADICGFLGDASEELCVRWMQL
GAFYPFMRNHNDWVTLPAPLETINVHIRAGHIIPLQAPGLTTTESRTQDMILIVALTPSG
VARGQLFWDDGESLGTLERGAFTQIVFLANSNTIQNELVQASGEGAGLKLSKVSVLGVTG
TPKEVVINGAATANFTYRAETQILGIPVSLPLEDHFLISWS
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggccggggagggccccccacagtcctggcccccggcctcccggggagtgtcgcggacc
tgcgccctgactgccttggcgttgaccaccctcctgtgggcctccctcctccgcctgccc
ggcgcggtcctccaccaccccgcctctgcctccccaggaccgggagactccgaccgagcc
cgtcgagaggtcagaggtcggacgggggcccccggaggccaggaccccgcccggtgcgcg
gtgcccccggacgcccgcttcgactgcgcccccgagaagcccgtgagccggaaggagtgc
caagaccggggctgctgttacgcccccggtggggcggccccccggggggctcaggtctgg
cagccttggtgctttttccccccggacttccccacctaccgcctgcgcaacctcaccgtc
accccggggggctacaacgccaccctgacccgctccaaccgttccttcttcccccgggac
gtcctcaccctgcaactcaaggtcgtcctggagaaccaggcccggctccatttcacgatc
aaagacccggccaaccagcgttacgaagtgcccctggagaccccgaaagtgagcggccgg
gccccctccacgctatacgacgtggacttttcctgcgatcccttcggcctgatcgtccgc
aggaagtctaacgacctggtgctgctgaacacgacggtggccccgctgttcttcgcggac
cagttcctgcagctgtccacctccctgccgtctcactacgtcacggggctcggggagcac
cagacgcccctcatcctcagcaccaactggaccaagctcaccctgtggaaccgggacatg
gcgcccgctcccggcgccaacctctacggctcccaccccttctacctggtcctggaggag
agcgggaaggcccacggggtcttcctactgaacacctacgccatgtatgtggtgctgcag
cctactccagccctgacttacagaactgtcggcggcatcctggacttctacgtcttcctg
ggcccggagcccgggagcgtcgtgcgccagtacctggaggtggtaggctacccgctcttg
ccaccctactgggctctgggcttccacctgtgccgctggggctactcctccaccaccacc
acccgggaggtcgtcgagaacatgacggcggcccacttccccctggtagagannnnnnnn
nncatagattacatggacgccaagaaggatttttcattcaacaacgacaccttccgagac
ttccgggccatggtgncggagtatcaccggggcggccggagatacgtcatgatggaccca
gccatcagcagctccggtgccgcggggtcttacgggccctttgacgaagggctgaagaga
ggagtgttcattaccaacaagaccgggcagccgctgatcgggaaggtgtggccgggtgcc
accgtcttccccgacttcaccaaccccgagacccggctgtggtggcacgacatggtggcg
gacttccaccggcaggtgcccttcgacggcatgtggatcgacatgaacgagccgtccagc
ttcgtggacggctccgtggacggatgcccggacacccagctggacgacccgccgtacgtg
ccaggggtggttggtgggagtctgcgggcggcaaccatctgcgcctcgagctgccagtac
ctgtcttcccactacaacctgcacaacctatacgggctgtcggaagccgttgcgtcccac
gacgctctggtgaaggtgcggggcaaacgcccctttgtcatctcccgatcgaccttcgct
ggccacggccactacgcgggccactggaccggagacgtctggagcaactgggatcaactg
tactactccgtgccaggagtgctcctgtttaaccttttcggggtacctctggtgggggcc
gacatctgcggcttcctgggagacgcctcggaggagttgtgtgtgcgctggatgcagctg
ggggccttctaccccttcatgaggaaccacaacgactgggtcaccctccctgcccccctg
gagaccatcaatgtccacatccgagctggacacatcatcccgctgcaggcgcccggactc
acgaccacagagtcccgcacccaggacatgatcctgatcgtggccttgactcccagcgga
gtagcccggggtcagctattctgggacgacggggagagcctggggaccctagagcgggga
gccttcacccaaatcgtctttctggccaacagcaacaccatccagaacgagctggtgcag
gcgtctggcgagggggcgggcctgaagctgagcaaggtgtccgtcctgggcgtgaccggc
acccccaaagaggtcgtgatcaatggagctgccacggccaacttcacctaccgtgcggaa
acccagatcctgggcatcccggtgtctctgcctctagaggaccactttctcatcagctgg
tcctaa

DBGET integrated database retrieval system