KEGG   Ornithorhynchus anatinus (platypus): 100079609Help
Entry
100079609         CDS       T01045                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04015  Rap1 signaling pathway
oaa04371  Apelin signaling pathway
oaa04390  Hippo signaling pathway
oaa04514  Cell adhesion molecules (CAMs)
oaa04520  Adherens junction
oaa05100  Bacterial invasion of epithelial cells
oaa05200  Pathways in cancer
oaa05213  Endometrial cancer
oaa05216  Thyroid cancer
oaa05218  Melanoma
oaa05219  Bladder cancer
oaa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100079609 (CDH1)
   04390 Hippo signaling pathway
    100079609 (CDH1)
   04371 Apelin signaling pathway
    100079609 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100079609 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100079609 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100079609 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100079609 (CDH1)
   05216 Thyroid cancer
    100079609 (CDH1)
   05218 Melanoma
    100079609 (CDH1)
   05219 Bladder cancer
    100079609 (CDH1)
   05213 Endometrial cancer
    100079609 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100079609 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oaa03036]
    100079609 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:oaa04515]
    100079609 (CDH1)
   04090 CD molecules [BR:oaa04090]
    100079609 (CDH1)
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100079609 (CDH1)
Cell adhesion molecules [BR:oaa04515]
 Cadherins
  Major cadherins
   100079609 (CDH1)
CD molecules [BR:oaa04090]
 Proteins
  100079609 (CDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3 Big_9
Motif
Other DBs
NCBI-GeneID: 100079609
NCBI-ProteinID: XP_028931226
Ensembl: ENSOANG00000002356
LinkDB All DBs
Position
11
AA seq 886 aa AA seqDB search
MGTKRGCFCSLPSLAVSFLLLLIQAAPRQCEEVGGCQPGFSSDSYVFTVLRPHLERDQVL
GQVSFEDCSGSRRTAYLLEDTRFKVATNGVVAVKHPVWLHNLEMSFNIHAWDATGNKLST
KVTLKRAAQHHHHQESSPGEHSKVLLFPQSHSGLKRQKRDWVIPPINCPENEKGPFPKNL
VQIKSNRDKETRVYYSITGQGADKPPMGIFTIERESGWLKVTEPLDREKIPKYILQSHAV
TSDGKTVEEPMEIVITVTDQNDNKPQFTQEVFEGSVVEGSSPGTSVMQVNATDKDDPNTY
NAALVYSIVSQDPKDPQDNIFTINPTSGMITLLTSGLDRETIPQYKLIVQVADMNGEGLS
TTATAVINVADSNDNPPIFDSPVYVGQVRENEVNAEIVRLKVTDADVPNTKAWKAVYSVN
NEDGFFVVTTDPGTNEGILKTAKGLDFETKNKYTLYVTVVNEDPFAIELHTSTATVTVDV
MDENEAPVFVPPVKKVEVPEDFAVGQEITTYEAQDPDKFLQQKITYRIWRDDAKWLEINP
DSGLISPRASMDRENIEYVKNNTYTALIVAVDNGNPATTGTGTLLLTLSDVNDNGPIPDP
RKMDFCQRDYQAHTIHIIDKDLPPNTYPFQAELTHGAGVNWTLKMNTETRDELTLIPKKS
LEVGEYKINLKLTDNQNKDQVTTLEVYVCDCEGTVTNCKKIGPIAASSMGVPAILGILGG
ILALLLLLLLLLLFVRRRHVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGL
DARPEVTRNDVAPTSMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYE
GSGSEAASLSSLNSSGSDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atggggacgaagcggggctgcttctgcagcctcccctccctcgccgtctccttcctcctc
ctcctcatacaggcggcgccgaggcagtgcgaggaggtgggaggctgccagcctggcttc
agctccgacagctacgtgttcacggtgctccggccgcacctagaacgggaccaagtcctg
ggccaagtgagttttgaagactgctccggaagcaggagaacagcttaccttcttgaagac
acacgattcaaagtggcaaccaatggagtggttgcagtcaagcatcctgtatggcttcat
aacttagaaatgagtttcaacatccatgcttgggatgccactggcaacaagctctctact
aaagttaccctgaaaagagcagcacaacaccatcaccaccaggagtcttctcctggagaa
cattcaaaagtgctgctgttccctcaatcccactctggtctgaagagacagaagagggac
tgggttatccctcccatcaactgtcctgagaatgaaaagggaccgttccctaaaaatctg
gttcagatcaaatccaacagagacaaggagaccagggtttactacagtatcactggccaa
ggagcagataagcctcccatggggatcttcactattgaaagagaatctgggtggctgaaa
gtgacggaaccgctggacagagaaaaaattccaaaatacattcttcaatcccatgcagtg
acttctgatgggaagaccgtggaagaacctatggagattgtgattaccgtgactgatcag
aatgacaacaagccccagttcacccaggaggtctttgagggttcagtagtcgaaggatcc
tctccaggaacctctgtgatgcaagtcaacgccacagataaggatgatccgaacacttac
aatgcagcgcttgtttactctatcgtcagccaggatcctaaagatcctcaggataacata
ttcaccattaatccaacttccggcatgatcactttgctcacatcaggactggacagagag
actatcccgcagtataaactgattgtacaagttgctgacatgaatggtgaaggcttaagt
acaacggctacagcagtaataaatgtcgccgacagcaatgataacccacctatcttcgac
tccccagtgtatgtagggcaggtgcgggagaatgaggtaaatgctgaaattgtaagacta
aaagtgactgatgctgacgtccctaataccaaagcatggaaagcagtgtactctgttaat
aatgaagacggtttctttgttgtcaccactgacccaggaaccaatgaaggaatattaaaa
actgccaagggcttggactttgaaaccaaaaacaagtacacgctatatgtaactgtagtg
aacgaagatccatttgcaatcgaactccatacctccacagcaactgtcactgtggatgta
atggatgagaatgaagctcctgtctttgtgccaccagtcaagaaagtggaagtgccagaa
gactttgctgtcgggcaagagattactacctacgaggctcaggatccagacaagtttctc
caacagaagataacgtatcgcatttggagggatgacgctaaatggctggaaattaacccg
gattctgggcttatttcccctcgggctagtatggatagagagaatattgaatacgtgaag
aacaacacctacactgcccttatcgtggctgttgataatggtaaccccgcaaccactggt
actggaacccttctcctgaccctctcggacgtgaacgataatgggccgataccagaccct
cggaagatggacttctgtcagcgggattatcaggcccacactattcacatcatcgataag
gatcttcctccaaatacctatcctttccaggcagaacttacacacggagctggtgttaac
tggactttgaaaatgaatacggaaacaagagatgaactgaccctaataccaaaaaagtcg
ctcgaagtgggagagtacaagatcaatctcaagctgacagacaaccagaacaaggaccaa
gtgaccactttggaggtctatgtgtgtgactgtgaagggacagtcacaaactgtaaaaag
attgggccaatcgctgctagcagtatgggggtaccagccatcctgggaattctcggagga
atccttgccttgcttctcctgttgctgctgcttctcctgtttgtgcgaagaagacatgtg
gtgaaagagcctttgctgcccccagaagatgacacccgggataatgtttattactatgat
gaagagggaggtggcgaagaagaccaggactttgacttgagccagttgcataggggcctg
gatgctcgacctgaagttacccgtaacgatgtagccccaacttccatgagtgttccccag
taccgccctcgcccagccaacccagatgaaattggcaattttattgatgagaaccttaag
gctgcagacagtgaccccactgccccaccctatgattctttactggtgtttgattatgaa
ggaagcggctctgaagcagcatccctcagttctctgaactcttctggctcagatcaggac
caggactacgactacttgaacgaatggggcaatcgcttcaagaagttggctgatatgtat
ggtggtggggaggatgactag

DBGET integrated database retrieval system