KEGG   Ornithorhynchus anatinus (platypus): 100080281Help
Entry
100080281         CDS       T01045                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00010  Glycolysis / Gluconeogenesis
oaa00030  Pentose phosphate pathway
oaa00051  Fructose and mannose metabolism
oaa00052  Galactose metabolism
oaa01100  Metabolic pathways
oaa01200  Carbon metabolism
oaa01230  Biosynthesis of amino acids
oaa03018  RNA degradation
oaa04152  AMPK signaling pathway
oaa05230  Central carbon metabolism in cancer
Module
oaa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100080281 (PFKP)
   00030 Pentose phosphate pathway
    100080281 (PFKP)
   00051 Fructose and mannose metabolism
    100080281 (PFKP)
   00052 Galactose metabolism
    100080281 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100080281 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100080281 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100080281 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oaa01009]
    100080281 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oaa03019]
    100080281 (PFKP)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100080281 (PFKP)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100080281 (PFKP)
Messenger RNA biogenesis [BR:oaa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100080281 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100080281
NCBI-ProteinID: XP_001511162
LinkDB All DBs
Position
Un
AA seq 755 aa AA seqDB search
MNAAVRAVVRMGIYVEAKVYFVYEGYQGMVDGGDNIVEVSWENVSSILQVGGTVIGSARC
KAFRTREGRLKAALNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAREGKIEKEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEEQMCTKLSENRARKKRLNIIIVAEGAIDS
LNQPITSEKVKDLVVKQLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
VTPACVVSLCGNQAVRLPLMECVQMTQAVQKAMDERRFNEAVQLRGRSFENNLNTYKLLS
HKKPDAELPTSNFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHKMFAVTDGFEGFSRGQV
KEITWGDVGGWTGQGGSILGTKRTLPAKYLEQIAEQMRTHNINALLVIGGFEAYLGLLEL
SAAREKYDEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEQFDIRELQANVEHLTEKMKTSIQRGLVLRN
ENSNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWIS
RKLKETYRKGKIFANTDDSVCLLGMRRRNLLFQPVIALKHETDFVHRIPKEQWWLKLRPL
MKILAKYKTSYDVSDSGQLEHVAGCRPQEAETGAI
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgctgtccgggctgtagttcgaatgggaatttatgtcgaagccaaagtgtat
tttgtgtatgagggttatcaaggtatggtggatgggggagacaacattgttgaagtttca
tgggaaaatgtttcaagcattctccaagtgggagggacagtgattggcagtgcccgttgc
aaagcattccggacccgggaaggtcgcttaaaggcagctctcaatttgattcagcgtgga
atcactaacctgtgtgtgattggtggcgatggaagcttgacgggagccaacctctttcgg
gaagaatggagtggactactagaagaattggcacgagaaggcaagatcgaaaaagaggcc
gtgaagaagtacgcctacttaaacatcgtggggatggtcggctccatagacaatgacttc
tgtggaaccgacatgacaatcggcacggactctgccttgcacagaatcatcgaagtggtg
gatgccatcatgaccactgcccagagccatcagaggacctttgtgttagaagttatggga
agacactgtggatatctggccctcgtcagtgccttggcttgcggtgccgattgggtgttc
attcccgaataccccccagaagaagggtgggaagaacagatgtgcactaagctttcagag
aaccgcgcccgcaagaaaaggctgaacattatcatcgtggccgaaggagcgatcgactct
ctcaatcaacccattacgtcagagaaagtcaaagatctcgtggttaagcagctgggattt
gacacccgcgtgactatccttgggcacgtccaaagaggaggtaccccatcagctttcgac
cggattttggccagccgcatgggtgtggaggccgtcctggcccttctggaggcaaccccg
gtcacgccagcttgcgtggtgtccttgtgcggaaaccaggccgtgcgtctgcccctgatg
gagtgtgtgcagatgactcaggctgtgcagaaggcaatggacgagaggagatttaacgag
gccgtgcaactgaggggaaggagctttgagaacaatcttaatacctacaaactgctttct
cacaagaaaccagatgcagaactgccaacgagcaatttcaacgtggctgtcttgaacgtg
ggggctcccgcggcggggatgaacgctgccgtccgctcggcggtgagagtcggcatcacc
gaaggtcataagatgtttgcggtcaccgatgggtttgaaggattctcaagagggcaggta
aaagaaatcacctggggagatgttggaggctggactggccaaggaggatcaattcttggt
accaaacgtaccctccctgcaaagtatttggagcagattgctgaacagatgcgtactcat
aatatcaacgctctattggttattggtggatttgaggcctacctaggactgctggaactg
tcagccgcccgggagaaatatgacgagttctgtgttcctatggttatggtgcctgccacc
gtctccaacaatgtgccgggttcagatttcagcattggcgcagataccgctctgaacact
atcactgatacctgcgatcgcatcaagcagtcggccagcgggacgaagcgccgggtgttc
atcatcgaaacgatgggcggctactgcggttacctggccaacatggggggcctggcagcc
ggggcggacgccgcgtacatcttcgaggagcagttcgacatccgggaactgcaggctaac
gtggaacatttgactgagaagatgaagaccagcatccagcggggcctggtgctcaggaat
gagaacagcaatgaaaattataccactgatttcatctaccaactgtattctgaggaagga
aaaggagtatttgattgcagaaagaatgttttgggccatatgcaacagggtggagcaccc
tcgccatttgacagaaactttgggacaaaaatctccgctaaagccgtgcagtggatttct
agaaaactgaaggagacataccggaaaggaaaaatatttgccaacaccgatgactcagtt
tgtttgctaggaatgcgcagacggaatcttctcttccaacctgtaattgcactaaaacat
gaaacggattttgtgcaccggattcccaaggaacagtggtggttgaaactgaggcccctg
atgaagattctggccaagtacaaaaccagctatgacgtttccgactcgggtcagctggag
cacgtggcggggtgccgaccccaagaagcggaaactggagccatctag

DBGET integrated database retrieval system