KEGG   Ornithorhynchus anatinus (platypus): 100080302Help
Entry
100080302         CDS       T01045                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa05164  Influenza A
oaa05202  Transcriptional misregulation in cancer
oaa05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    100080302 (TMPRSS2)
   05215 Prostate cancer
    100080302 (TMPRSS2)
  09167 Infectious diseases
   05164 Influenza A
    100080302 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oaa01002]
    100080302 (TMPRSS2)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100080302 (TMPRSS2)
Peptidases [BR:oaa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100080302 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 SRCR Ldl_recept_a Trypsin_2 P12
Motif
Other DBs
NCBI-GeneID: 100080302
NCBI-ProteinID: XP_007665398
LinkDB All DBs
Position
Un
AA seq 492 aa AA seqDB search
MALNSGIPPYGPYYENRGYQPENFSPPRHPGDPTAYVPYPAPYYPSPVPQYIPRVLTHSS
SPSVLVQPKPPSGIVVTSKAKKVICIAFSVAILLIGAVIAAIFIWKFFENKCSGSGIECG
SSGTCISPSFWCDGISHCPSGEDENRCVRLYGPKFVLQVYSSQNKSWYPVCQDDWNDDYG
KIACKDMGYNRNSFHLSHGVTDSSGATSFMKLNMSSRNIDLYKKLYNSDVCSSKMVVSLR
CIECGTASRASQLNRIVGGAVASPGEWPWQVSLHVQGVHVCGGSIITSEWIVTAAHCVEE
PVSSPRYWTVFAGILRQSAMFYGSGYKVQKIISHPNYDTKSKNNDIALMKLQAPLTFNEN
VRPVCLPNPGMMFEPNQQCWISGWGATHEKGKTSDVLNAVTVPIIEPWKCNSRYVYNHLI
TPAMICAGYLKGGIDSCQGDSGGPLVTEKDALWWLVGDTSWGSGCAKANRPGVYGNLTLF
TDWIYRQMQAYS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcagggataccaccatacggaccctattatgaaaaccgtggttatcag
cccgaaaacttctctcctccaaggcatcctggagatcccactgcttatgtgccttaccca
gctccgtactatccttctccagtgcctcagtacatccccagggtcctaacgcacagttcc
tcaccctcagtcctcgttcaacccaaaccgccatccgggatcgtggttacctcaaaggct
aaaaaggtgatatgcattgccttttcagttgcaatacttttaattggtgctgtgattgcg
gccatttttatctggaagttttttgaaaataagtgttcgggctctggaatagagtgcggg
tcatcagggacctgtatcagtccctctttctggtgtgatggcatatcccattgccccagt
ggcgaagatgaaaaccgttgcgttcgtctctatgggccaaagttcgtccttcaggtttac
tcatctcaaaacaaatcctggtatcctgtctgccaagacgattggaatgatgattatggg
aagatagcatgtaaagacatggggtataacaggaatagcttccacttgagtcacggagta
accgattccagtggtgctacaagtttcatgaagctgaacatgagttccaggaacatagat
ctgtataagaagctatacaacagtgacgtctgttcctccaagatggtggtgtctctgcgc
tgcatagagtgcggcacggcctccagagcgagccagttgaaccggatcgttgggggggcg
gtggcaagcccgggggagtggccctggcaggtcagcttgcacgtccaaggagtccacgtc
tgcggcggctccatcatcacttcggaatggatcgtcactgcagctcactgcgtggaagaa
cctgtttccagtccacgttactggacagtatttgcaggtattctgagacaatctgccatg
ttctatgggagtggatacaaagtgcagaaaataatttctcatccaaattacgacaccaag
tcaaagaacaacgacatcgcccttatgaagttgcaagctccattaacgttcaatgagaac
gtaagaccggtgtgcctgcctaaccccggaatgatgttcgagcccaatcagcagtgctgg
atatctggatggggcgccacacacgaaaagggaaaaacctcagacgtgttgaatgcagta
acggtaccaattatagaaccatggaaatgcaatagtagatacgtctacaatcaccttatc
acaccggccatgatttgtgcaggttatctcaagggagggattgattcctgccagggtgac
agcggaggccctttggtcactgagaaagatgccctatggtggttagttggggatacgagt
tggggatccggctgcgccaaggccaacagacctggagtctatggaaacctgaccctattt
accgactggatttaccgtcagatgcaggcttacagttga

DBGET integrated database retrieval system