KEGG   Ornithorhynchus anatinus (platypus): 100080577
Entry
100080577         CDS       T01045                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04072  Phospholipase D signaling pathway
oaa04151  PI3K-Akt signaling pathway
oaa04640  Hematopoietic cell lineage
oaa04916  Melanogenesis
oaa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100080577 (KITLG)
   04014 Ras signaling pathway
    100080577 (KITLG)
   04015 Rap1 signaling pathway
    100080577 (KITLG)
   04072 Phospholipase D signaling pathway
    100080577 (KITLG)
   04151 PI3K-Akt signaling pathway
    100080577 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100080577 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100080577 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100080577 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oaa04052]
    100080577 (KITLG)
Cytokines and growth factors [BR:oaa04052]
 Growth factors
  Growth factors (RTK binding)
   100080577 (KITLG)
SSDB
Motif
Pfam: SCF B2 Psg1
Other DBs
NCBI-GeneID: 100080577
NCBI-ProteinID: XP_007668267
UniProt: A0A6I8NLQ3
LinkDB
Position
14
AA seq 273 aa
MKKTQTWIITCIYLQLLLFIPLIRAQKNCGNPVTDDVKDITKLVGNLPNDYMIALKYVPE
MDGLPNHCWLHLMVPELAKSLNNLLQKFSEISESLSNYSIINNLTRIIDDLMACLASDKN
KHFVQRNIHLYKKGSFIPKEFFGYFNRSIEAFRDFQAEHSDCIFPTTTLMPEKDSRVSVT
KPFLLPPVAASSLKNDSTSSNREAFGYISSSSLQWISIAVPSIFSLVIGFILGAIYWKKK
HPKHSVEVENIQGNEEDNEISMLQERERELQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactactcctatttatt
cctctcatcagagctcaaaagaactgtgggaatcctgtgacagatgatgtgaaggacatt
acaaaattggttggaaatcttccaaatgattatatgatagcccttaaatatgtcccagag
atggatggtctgcctaatcactgttggttgcatctgatggttcctgaattggccaaaagt
ttgaataatcttctccaaaaattttcagagatttctgaatctctaagtaattattccatc
atcaataatctcacaagaataatagatgacctcatggcatgcctagcttctgataaaaat
aagcattttgtacaaagaaatatccacctttataaaaaaggcagtttcattcctaaagaa
ttctttggatactttaatcgctctatagaagccttcagggactttcaagcagagcacagt
gactgcatttttcctacaacaacattaatgccagagaaagattccagagtcagtgtcaca
aaaccatttttgttaccccccgttgcagccagctcccttaagaatgacagcactagcagt
aatagagaagcctttggttacattagcagctctagcctgcaatggataagcatagcagtg
ccatccattttttctcttgtcatcggctttatccttggagctatatactggaagaaaaaa
catccaaaacactcagtggaagttgaaaatatacagggtaatgaagaggataatgagata
agtatgttgcaagaacgagagagagagcttcaagaagtgtaa

DBGET integrated database retrieval system