KEGG   Ornithorhynchus anatinus (platypus): 100080771
Entry
100080771         CDS       T01045                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04022  cGMP-PKG signaling pathway
oaa04141  Protein processing in endoplasmic reticulum
oaa04151  PI3K-Akt signaling pathway
oaa04211  Longevity regulating pathway
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04668  TNF signaling pathway
oaa04728  Dopaminergic synapse
oaa04911  Insulin secretion
oaa04915  Estrogen signaling pathway
oaa04918  Thyroid hormone synthesis
oaa04925  Aldosterone synthesis and secretion
oaa04926  Relaxin signaling pathway
oaa04927  Cortisol synthesis and secretion
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04934  Cushing syndrome
oaa04935  Growth hormone synthesis, secretion and action
oaa05020  Prion disease
oaa05030  Cocaine addiction
oaa05031  Amphetamine addiction
oaa05034  Alcoholism
oaa05161  Hepatitis B
oaa05163  Human cytomegalovirus infection
oaa05166  Human T-cell leukemia virus 1 infection
oaa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100080771 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100080771 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100080771 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100080771 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100080771 (ATF6B)
   04915 Estrogen signaling pathway
    100080771 (ATF6B)
   04926 Relaxin signaling pathway
    100080771 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100080771 (ATF6B)
   04918 Thyroid hormone synthesis
    100080771 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100080771 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100080771 (ATF6B)
   04927 Cortisol synthesis and secretion
    100080771 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100080771 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100080771 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100080771 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100080771 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100080771 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100080771 (ATF6B)
   05031 Amphetamine addiction
    100080771 (ATF6B)
   05034 Alcoholism
    100080771 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100080771 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100080771 (ATF6B)
   05161 Hepatitis B
    100080771 (ATF6B)
   05163 Human cytomegalovirus infection
    100080771 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oaa03000]
    100080771 (ATF6B)
Transcription factors [BR:oaa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100080771 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA NYD-SP28_assoc KASH_CCD
Other DBs
NCBI-GeneID: 100080771
NCBI-ProteinID: XP_028911165
LinkDB
Position
X5
AA seq 700 aa
MAAELLVLSDIADPARFFADNLLSAEDWDSSLYTCLDGGSEEQTQLFRCLDLDVPLDSGS
LDLDMDISPPEPPWDLLPIFPDLQVKSEPSSPCSSSSSSSSSSPPSSESSLSTEPPGLAP
SAEETSAVKAEAPGARLCLLGDDLTLPPDSVQITVGSSPDDPPDAEAKSEPASPSSPLSS
SQAVLAAESPGQILGVKEVLGFKKESQAPQLCLLGDVLPPAFGSVQISVGPLPDGPSGQA
QPQRKPLLQPKPVIVTSVPLAASASSPSPAVLLQPLAQPPPVPPGPPVVLLHGPVRVQAP
PVDGPAPPAPRPERKSIVPAPTAGTPCPPEAKLLKRQQRMIKNRESACQSRRKKKEYVQG
LEARLQAILADNQQLRRENAALRRRLEGLLAENSELKFGAGNRKVVCVMVFLLFIAFNFG
PVSITESPSAPASLREKGEEPRPRRHLLEFSGDPPREAPPAPEEPRPSAPSRPRFRNLTA
YPGGVKELLLRDLDQLFLSPDCRHFNRTESLRLADELSGWVRRHQSGRKRSPQPRRARER
QKSQLRMKSPPARAVPPHPPGPPERESLSQLQLYRHPKHSEPEFLDAIDRREDTFYVVSF
RRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPGDYEVMMQIECEVMDTRVIHIK
SSTVPPSLRPAPGNATRDPLPPPAPTRRPPLHRPLYLGQP
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcggcggagctgctggtcctcagcgacatcgccgacccggcgcgtttcttcgccgac
aatctgctgagcgccgaggactgggacagcagcctgtacacctgcctggatggagggtcg
gaggagcagacgcagctcttccgctgcctggacctggacgtcccgctggacagtggctcc
ctggacctggacatggacatcagccccccggagcccccctgggacctgctacccatcttt
ccagatctgcaggtgaaatcagaaccgtcctccccctgctcctcctcctcctcctcctcc
tcctcctccccccccagctccgagtcatcgctgtccacagagccccccggcctggccccc
agtgcggaggagacgtcggctgtgaaggcggaggcaccgggcgcccggctctgcctcctg
ggagatgacctgaccctcccgccagactccgttcagatcactgtgggctcctcccccgac
gaccccccagatgccgaggccaagtcagagcccgcgtccccgtcctctccgctcagctcc
tcacaggccgtcctcgccgcggagtctcccggccagattttgggggtgaaggaggtgctg
ggtttcaagaaggaatcccaggccccccagctttgccttctgggggacgtcctgcccccc
gccttcggctccgtccagatcagcgtgggtcccctccccgacggcccctcaggtcaggcc
cagccccagcggaagcctctgttacagccgaaaccggtgatcgtgacgtccgtcccgctg
gctgccagcgcctcgtctcccagccccgccgtcctgctgcagcccctcgcccagccccca
ccagtcccccccggacccccggtcgtcctgcttcacgggcccgtgcgcgttcaggccccc
ccggtggatgggccggccccgcccgcccccaggcccgagaggaagagcatcgtccccgcg
cccacggccgggaccccctgcccccctgaggcgaagctgctgaagcggcagcagcggatg
atcaagaaccgcgagtcggcctgccagtcccggcggaagaagaaggagtacgtgcagggc
ctggaggcccggctccaggccatcctggccgacaaccagcagctgcgcagggagaatgcc
gccctgcgccgacgcctcgaggggctcctggccgagaacagcgaattgaagttcggagcc
gggaacaggaaggtggtctgcgtcatggtcttcctactgttcatcgccttcaactttggg
cccgtcagcatcaccgagtcaccctcggcccccgcctcgctccgggagaagggcgaggag
ccgcggccccggaggcacctgctggagttctcgggggacccgccccgggaggcgcccccg
gccccggaggagccccggcccagcgcccccagccggccccgcttcaggaacctgaccgcc
taccctgggggcgtgaaggagctgctgctcagagacctggaccagctcttcttgtcccca
gactgtcgccacttcaaccgtaccgagtccctgcggctggccgatgaactgagcggctgg
gtccggcggcaccagagcgggcgcaagagaagcccccagccccggagggcacgcgagaga
cagaagtcccaactacggatgaagtcacctccagcccgtgccgtccccccgcaccctcct
ggccctcctgaaagggagtccctgagccagctgcagctctaccgccaccccaagcattcg
gagccggagttcttagatgccatcgacaggcgcgaggacaccttctacgtcgtctccttc
cgccgggaccaccttctcctgccagccatcagccacaacaagacgtcccggcccaagatg
tccttagtgatgcccgccatggcccccaacgagacgctttccggcagaggccccggggac
tacgaggtcatgatgcagatcgagtgtgaggtgatggacactcgcgtgatccacatcaag
agctccaccgtgccaccctccctccgcccggcccccggcaacgccacccgggaccccctg
cccccgccggcccccacccgtcgccctcccctccaccggcccctctacctcggccagccc
tga

DBGET integrated database retrieval system